Result : P64629
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YhfL |
| NCBI Accession ID | AE005174.2 |
| Organism | Escherichia coli O157:H7 |
| Left | 4286584 |
| Right | 4286751 |
| Strand | + |
| Nucleotide Sequence | ATGAACAAATTTATTAAAGTTGCACTGGTAGGTGCAGTACTGGCTACGTTAACTGCATGTACTGGTCATATTGAAAACCGTGATAAGAACTGCTCTTACGACTACCTGCTGCACCCAGCAATTTCTATTTCTAAAATCATTGGCGGTTGCGGTCCTACTGCACAGTAA |
| Sequence | MNKFIKVALVGAVLATLTACTGHIENRDKNCSYDYLLHPAISISKIIGGCGPTAQ |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of pfam13978. Profile Description: Protein of unknown function (DUF4223). This family of proteins is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are approximately 60 amino acids in length. These proteins are likely to be lipoproteins (attachment site currently included in alignment). |
| Pubmed ID | 11206551 11258796 |
| Domain | CDD:404801 |
| Functional Category | Others |
| Uniprot ID | P64629 |
| ORF Length (Amino Acid) | 55 |
++ More..
| Conservation Analysis |
No. of Species: 47
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 4219490 | 4219657 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 2 | 3499448 | 3499615 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 3 | 3468666 | 3468833 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 4 | 3987587 | 3987754 | + | NZ_LR134340.1 | Escherichia marmotae |
| 5 | 2404324 | 2404491 | + | NZ_CP057657.1 | Escherichia fergusonii |
| 6 | 3460407 | 3460574 | + | NZ_AP014857.1 | Escherichia albertii |
| 7 | 4694667 | 4694834 | - | NC_013716.1 | Citrobacter rodentium ICC168 |
| 8 | 3635940 | 3636110 | + | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
| 9 | 1485064 | 1485234 | + | NZ_CP053416.1 | Salmonella bongori |
| 10 | 2779508 | 2779675 | - | NZ_CP028271.1 | Mixta intestinalis |
| 11 | 2778244 | 2778414 | - | NZ_CP044098.1 | Citrobacter portucalensis |
| 12 | 33792 | 33962 | - | NZ_CP012268.1 | Cronobacter muytjensii ATCC 51329 |
| 13 | 4007979 | 4008149 | + | NZ_CP012264.1 | Cronobacter condimenti 1330 |
| 14 | 3931332 | 3931502 | + | NZ_CP012257.1 | Cronobacter universalis NCTC 9529 |
| 15 | 2290201 | 2290371 | + | NZ_CP033744.1 | Citrobacter freundii |
| 16 | 3753282 | 3753452 | - | NZ_CP027107.1 | Cronobacter sakazakii |
| 17 | 183188 | 183358 | - | NZ_CP013940.1 | Cronobacter malonaticus LMG 23826 |
| 18 | 4351933 | 4352103 | + | NC_015968.1 | Enterobacter soli |
| 19 | 4098538 | 4098708 | + | NZ_CP012266.1 | Cronobacter dublinensis subsp. dublinensis LMG 23823 |
| 20 | 3791050 | 3791220 | - | NZ_CP038469.1 | Citrobacter tructae |
| 21 | 4397386 | 4397556 | + | NC_009792.1 | Citrobacter koseri ATCC BAA-895 |
| 22 | 404302 | 404472 | - | NZ_CP013990.1 | Leclercia adecarboxylata |
| 23 | 4308443 | 4308616 | + | NZ_CP050150.1 | Hafnia alvei |
| 24 | 2075867 | 2076037 | + | NZ_AP019007.1 | Enterobacter oligotrophicus |
| 25 | 5067093 | 5067260 | - | NZ_CP020388.1 | Pluralibacter gergoviae |
| 26 | 4440465 | 4440635 | + | NZ_CP009756.1 | Enterobacter cloacae |
| 27 | 2899140 | 2899310 | + | NZ_CP017279.1 | Enterobacter ludwigii |
| 28 | 4336484 | 4336654 | + | NZ_CP017184.1 | Enterobacter roggenkampii |
| 29 | 2963044 | 2963214 | - | NZ_CP025034.2 | Enterobacter sp. SGAir0187 |
| 30 | 4006578 | 4006748 | - | NZ_CP045769.1 | Enterobacter cancerogenus |
| 31 | 4234050 | 4234220 | + | NZ_AP022508.1 | Enterobacter bugandensis |
| 32 | 3039012 | 3039182 | + | NZ_CP023529.1 | Lelliottia amnigena |
| 33 | 3406896 | 3407063 | - | NZ_CP061511.1 | Mixta calida |
| 34 | 4324210 | 4324380 | + | NZ_CP027986.1 | Enterobacter sichuanensis |
| 35 | 358149 | 358322 | - | NZ_AP023184.1 | Buttiauxella agrestis |
| 36 | 1621332 | 1621499 | - | NZ_LT556085.1 | Citrobacter amalonaticus |
| 37 | 2172761 | 2172928 | - | NZ_CP040428.1 | Jejubacter calystegiae |
| 38 | 340860 | 341030 | - | NZ_CP054058.1 | Scandinavium goeteborgense |
| 39 | 315106 | 315273 | - | NZ_CP047349.1 | Proteus terrae subsp. cibarius |
| 40 | 1893154 | 1893321 | - | NZ_CP026364.1 | Proteus hauseri |
| 41 | 418288 | 418461 | - | NZ_CP045845.1 | Kluyvera intermedia |
| 42 | 3786163 | 3786330 | - | NC_010554.1 | Proteus mirabilis HI4320 |
| 43 | 1557884 | 1558051 | + | NZ_CP045205.1 | Citrobacter telavivensis |
| 44 | 97737 | 97904 | - | NZ_CP067059.1 | Rahnella aceris |
| 45 | 2175982 | 2176152 | + | NZ_CP029822.1 | Entomomonas moraniae |
| 46 | 3989968 | 3990135 | - | NZ_CP049044.1 | Pseudomonas psychrophila |
| 47 | 2081437 | 2081598 | - | NZ_LS483250.1 | Moritella yayanosii |
| 48 | 1787145 | 1787297 | - | NZ_AP019651.1 | Vibrio taketomensis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_002695.2
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00590.22 | 0.62 | 29 | 249.0 | same-strand | Tetrapyrrole (Corrin/Porphyrin) Methylases |
| 2 | PF13241.8 | 0.62 | 29 | 249.0 | same-strand | Putative NAD(P)-binding |
| 3 | PF10414.11 | 0.62 | 29 | 249.0 | same-strand | Sirohaem synthase dimerisation region |
| 4 | PF14824.8 | 0.62 | 29 | 249.0 | same-strand | Sirohaem biosynthesis protein central |
++ More..