Protein Information |
Information Type | Description |
---|---|
Protein name | Inner membrane protein YhdU |
NCBI Accession ID | U18997.1 |
Organism | Escherichia coli (strain K12) |
Left | 193367 |
Right | 193546 |
Strand | + |
Nucleotide Sequence | ATGATTCGCAAGTATTGGTGGCTCGTCGTTTTCGCTGTCTTCGTTTTTCTGTTTGATACTTTACTGATGCAGTGGATTGAACTGCTGGCAACAGAAACAGACAAATGCCGCAATATGAACTCAGTTAATCCACTAAAACTGGTTAACTGTGACGAACTGAATTTTCAGGACAGAATGTGA |
Sequence | MIRKYWWLVVFAVFVFLFDTLLMQWIELLATETDKCRNMNSVNPLKLVNCDELNFQDRM |
Source of smORF | Swiss-Prot |
Function | The ORF matches to the profile of pfam10831. Profile Description: Protein of unknown function (DUF2556). This family of proteins with unknown function appears to be restricted to Enterobacteriaceae. |
Pubmed ID | 9278503 16738553 |
Domain | CDD:402452 |
Functional Category | Others |
Uniprot ID | P64619 |
ORF Length (Amino Acid) | 59 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 3412621 | 3412800 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
2 | 4147708 | 4147887 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
3 | 3400192 | 3400392 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
4 | 3915964 | 3916143 | + | NZ_LR134340.1 | Escherichia marmotae |
5 | 3392731 | 3392910 | + | NZ_AP014857.1 | Escherichia albertii |
6 | 4092458 | 4092622 | - | NZ_CP045769.1 | Enterobacter cancerogenus |
7 | 4235313 | 4235477 | + | NZ_CP027986.1 | Enterobacter sichuanensis |
8 | 4358278 | 4358442 | + | NZ_CP009756.1 | Enterobacter cloacae |
9 | 1989179 | 1989343 | + | NZ_AP019007.1 | Enterobacter oligotrophicus |
10 | 4161348 | 4161512 | + | NZ_AP022508.1 | Enterobacter bugandensis |
11 | 4590356 | 4590520 | + | NZ_CP043318.1 | Enterobacter chengduensis |
12 | 2955687 | 2955851 | + | NZ_CP023529.1 | Lelliottia amnigena |
13 | 4147993 | 4148157 | - | NZ_CP017279.1 | Enterobacter ludwigii |
14 | 4268621 | 4268785 | + | NC_015968.1 | Enterobacter soli |
15 | 4254247 | 4254411 | + | NZ_CP017184.1 | Enterobacter roggenkampii |
16 | 3045422 | 3045586 | - | NZ_CP025034.2 | Enterobacter sp. SGAir0187 |
17 | 3866473 | 3866637 | - | NZ_CP038469.1 | Citrobacter tructae |
18 | 4311085 | 4311249 | + | NC_009792.1 | Citrobacter koseri ATCC BAA-895 |
19 | 3557618 | 3557782 | + | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
20 | 1693756 | 1693920 | - | NZ_LT556085.1 | Citrobacter amalonaticus |
21 | 487695 | 487859 | - | NZ_CP013990.1 | Leclercia adecarboxylata |
22 | 5434453 | 5434617 | + | NZ_CP045205.1 | Citrobacter telavivensis |
23 | 430174 | 430338 | - | NZ_CP054058.1 | Scandinavium goeteborgense |
24 | 2333992 | 2334156 | + | NZ_CP057657.1 | Escherichia fergusonii |
25 | 4140556 | 4140720 | + | NZ_CP012871.1 | [Enterobacter] lignolyticus |
26 | 4798919 | 4799083 | - | NC_013716.1 | Citrobacter rodentium ICC168 |
27 | 5176436 | 5176600 | - | NZ_CP011602.1 | Phytobacter ursingii |
28 | 1014295 | 1014459 | - | NZ_CP051548.1 | Phytobacter diazotrophicus |
29 | 486790 | 486951 | - | NZ_CP014007.2 | Kosakonia oryzae |
30 | 4837297 | 4837458 | + | NZ_CP015113.1 | Kosakonia radicincitans |
31 | 441058 | 441219 | - | NZ_CP035129.1 | Kosakonia cowanii |
32 | 4409862 | 4410023 | + | NZ_CP063425.1 | Kosakonia pseudosacchari |
33 | 2659788 | 2659949 | + | NZ_CP016337.1 | Kosakonia sacchari |
34 | 417115 | 417288 | + | NZ_CP020388.1 | Pluralibacter gergoviae |
35 | 1407967 | 1408131 | + | NZ_CP053416.1 | Salmonella bongori |
36 | 2868151 | 2868315 | - | NZ_CP044098.1 | Citrobacter portucalensis |
37 | 2214565 | 2214729 | + | NZ_CP033744.1 | Citrobacter freundii |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00474.19 | 0.69 | 25 | 3558.5 | same-strand | Sodium:solute symporter family |
2 | PF06325.15 | 0.94 | 34 | 2670 | same-strand | Ribosomal protein L11 methyltransferase (PrmA) |
3 | PF01207.19 | 0.94 | 34 | 501 | same-strand | Dihydrouridine synthase (Dus) |
4 | PF02954.21 | 0.94 | 34 | 181 | same-strand | Bacterial regulatory protein, Fis family |
5 | PF08361.13 | 0.75 | 27 | 1178.0 | opposite-strand | MAATS-type transcriptional repressor, C-terminal region |
6 | PF00440.25 | 0.75 | 27 | 1178.0 | opposite-strand | Bacterial regulatory proteins, tetR family |
7 | PF16576.7 | 0.75 | 27 | 2689.5 | same-strand | Barrel-sandwich domain of CusB or HlyD membrane-fusion |
8 | PF00529.22 | 0.75 | 27 | 2689.5 | same-strand | Cation efflux system protein CusB domain 1 |
9 | PF13437.8 | 0.75 | 27 | 2689.5 | same-strand | HlyD family secretion protein |
10 | PF13533.8 | 0.72 | 26 | 2164 | same-strand | Biotin-lipoyl like |
11 | PF00873.21 | 0.75 | 27 | 4367 | same-strand | AcrB/AcrD/AcrF family |
12 | PF00563.22 | 0.61 | 22 | 141.0 | same-strand | EAL domain |
13 | PF03707.18 | 0.61 | 22 | 140.5 | same-strand | Bacterial signalling protein N terminal repeat |