Result : P64618
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YhcO |
| NCBI Accession ID | AE005174.2 |
| Organism | Escherichia coli O157:H7 |
| Left | 4188311 |
| Right | 4188583 |
| Strand | - |
| Nucleotide Sequence | ATGAATATTTATACCTTTGATTTTGATGAGATTGAGAGTCAGGAGGATTTTTATCGTGACTTTAGCCAAACCTTTGGTCTGGCGAAAGATAAGGTACGCGATCTCGACTCACTATGGGATGTGTTAATGAACGATGTCCTGCCGCTACCACTTGAGATTGAATTTGTTCATCTGGGAGAGAAAACGCGTCGCCGTTTTGGCGCGTTAATATTGCTGTTTGATGAGGCAGAGGAAGAGCTGGAAGGGCATTTGCGTTTTAATGTTCGTCATTAG |
| Sequence | MNIYTFDFDEIESQEDFYRDFSQTFGLAKDKVRDLDSLWDVLMNDVLPLPLEIEFVHLGEKTRRRFGALILLFDEAEEELEGHLRFNVRH |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl01048. Profile Description: N/A. Barstar_SaI14_like contains sequences that are similar to SaI14, an RNAase inhibitor, which are members of the Barstar family. Barstar is an intracellular inhibitor of barnase, an extracellular ribonuclease of Bacillus amyloliquefaciens. Barstar binds tightly to the barnase active site and sterically blocks it thus inhibiting its potentially lethal RNase activity inside the cell. The sequences in this subfamily are mostly uncharacterized, but believed to have a similar function and role. |
| Pubmed ID | 11206551 11258796 |
| Domain | CDD:412713 |
| Functional Category | Others |
| Uniprot ID | P64618 |
| ORF Length (Amino Acid) | 90 |
++ More..
| Conservation Analysis |
No. of Species: 96
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3385857 | 3386129 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 2 | 4121222 | 4121494 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 3 | 438043 | 438315 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 4 | 3373708 | 3373980 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 5 | 3888263 | 3888535 | - | NZ_LR134340.1 | Escherichia marmotae |
| 6 | 3359907 | 3360179 | - | NZ_AP014857.1 | Escherichia albertii |
| 7 | 2306500 | 2306772 | - | NZ_CP057657.1 | Escherichia fergusonii |
| 8 | 1725184 | 1725456 | + | NZ_LT556085.1 | Citrobacter amalonaticus |
| 9 | 5400100 | 5400372 | - | NZ_CP045205.1 | Citrobacter telavivensis |
| 10 | 4280834 | 4281109 | - | NC_009792.1 | Citrobacter koseri ATCC BAA-895 |
| 11 | 3894762 | 3895040 | + | NZ_CP038469.1 | Citrobacter tructae |
| 12 | 3529563 | 3529835 | - | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
| 13 | 2896563 | 2896841 | + | NZ_CP044098.1 | Citrobacter portucalensis |
| 14 | 2186010 | 2186288 | - | NZ_CP033744.1 | Citrobacter freundii |
| 15 | 1379451 | 1379723 | - | NZ_CP053416.1 | Salmonella bongori |
| 16 | 4828072 | 4828344 | + | NC_013716.1 | Citrobacter rodentium ICC168 |
| 17 | 516733 | 517005 | + | NZ_CP013990.1 | Leclercia adecarboxylata |
| 18 | 2926556 | 2926831 | - | NZ_CP023529.1 | Lelliottia amnigena |
| 19 | 459854 | 460129 | + | NZ_CP054058.1 | Scandinavium goeteborgense |
| 20 | 4121477 | 4121749 | + | NZ_CP045769.1 | Enterobacter cancerogenus |
| 21 | 2183468 | 2183746 | + | NZ_CP042941.1 | Atlantibacter hermannii |
| 22 | 4131392 | 4131664 | - | NZ_AP022508.1 | Enterobacter bugandensis |
| 23 | 4224301 | 4224573 | - | NZ_CP017184.1 | Enterobacter roggenkampii |
| 24 | 3075266 | 3075538 | + | NZ_CP025034.2 | Enterobacter sp. SGAir0187 |
| 25 | 4177848 | 4178120 | + | NZ_CP017279.1 | Enterobacter ludwigii |
| 26 | 4221799 | 4222071 | - | NC_015968.1 | Enterobacter soli |
| 27 | 4205367 | 4205639 | - | NZ_CP027986.1 | Enterobacter sichuanensis |
| 28 | 1959233 | 1959505 | - | NZ_AP019007.1 | Enterobacter oligotrophicus |
| 29 | 4560406 | 4560678 | - | NZ_CP043318.1 | Enterobacter chengduensis |
| 30 | 4330044 | 4330316 | - | NZ_CP009756.1 | Enterobacter cloacae |
| 31 | 461839 | 462111 | + | NZ_AP023184.1 | Buttiauxella agrestis |
| 32 | 486352 | 486627 | + | NZ_LR134475.1 | Klebsiella aerogenes |
| 33 | 3738664 | 3738936 | - | NZ_CP013940.1 | Cronobacter malonaticus LMG 23826 |
| 34 | 523697 | 523972 | + | NZ_CP045845.1 | Kluyvera intermedia |
| 35 | 5203490 | 5203756 | + | NZ_CP011602.1 | Phytobacter ursingii |
| 36 | 1041318 | 1041584 | + | NZ_CP051548.1 | Phytobacter diazotrophicus |
| 37 | 369733 | 370008 | - | NZ_CP020388.1 | Pluralibacter gergoviae |
| 38 | 3019208 | 3019480 | - | NZ_CP027107.1 | Cronobacter sakazakii |
| 39 | 491363 | 491638 | + | NZ_CP054254.1 | Klebsiella variicola |
| 40 | 4113056 | 4113331 | - | NZ_CP012871.1 | [Enterobacter] lignolyticus |
| 41 | 481611 | 481886 | + | NZ_CP065838.1 | Klebsiella quasipneumoniae |
| 42 | 4528194 | 4528457 | - | NC_014306.1 | Erwinia billingiae Eb661 |
| 43 | 3619970 | 3620239 | + | NZ_CP045300.1 | Kosakonia arachidis |
| 44 | 4793360 | 4793635 | - | NC_016845.1 | Klebsiella pneumoniae subsp. pneumoniae HS11286 |
| 45 | 566685 | 566960 | + | NZ_CP060111.1 | Klebsiella michiganensis |
| 46 | 4809876 | 4810145 | - | NZ_CP015113.1 | Kosakonia radicincitans |
| 47 | 4289044 | 4289319 | + | NZ_CP028271.1 | Mixta intestinalis |
| 48 | 3552736 | 3553005 | - | NZ_CP034148.1 | Pantoea agglomerans |
| 49 | 654245 | 654526 | - | NZ_CP040428.1 | Jejubacter calystegiae |
| 50 | 2632451 | 2632720 | - | NZ_CP016337.1 | Kosakonia sacchari |
| 51 | 4382525 | 4382794 | - | NZ_CP063425.1 | Kosakonia pseudosacchari |
| 52 | 528468 | 528737 | + | NZ_CP038853.1 | Pantoea vagans |
| 53 | 294920 | 295192 | + | NZ_CP023525.1 | Cedecea neteri |
| 54 | 300752 | 301024 | + | NZ_LR134201.1 | Cedecea lapagei |
| 55 | 518390 | 518659 | + | NZ_CP045720.1 | Pantoea eucalypti |
| 56 | 422899 | 423171 | + | NZ_CP012266.1 | Cronobacter dublinensis subsp. dublinensis LMG 23823 |
| 57 | 1199601 | 1199876 | - | NZ_CP026047.1 | Raoultella planticola |
| 58 | 478655 | 478930 | + | NZ_CP041247.1 | Raoultella electrica |
| 59 | 465498 | 465770 | + | NZ_CP061511.1 | Mixta calida |
| 60 | 1125471 | 1125758 | - | NZ_CP019706.1 | Pantoea alhagi |
| 61 | 516897 | 517172 | + | NZ_CP046672.1 | Raoultella ornithinolytica |
| 62 | 514121 | 514390 | + | NZ_CP014007.2 | Kosakonia oryzae |
| 63 | 427952 | 428224 | + | NZ_CP012264.1 | Cronobacter condimenti 1330 |
| 64 | 3615927 | 3616199 | - | NZ_CP012268.1 | Cronobacter muytjensii ATCC 51329 |
| 65 | 540018 | 540290 | + | NZ_CP026377.1 | Mixta gaviniae |
| 66 | 469081 | 469350 | + | NZ_CP035129.1 | Kosakonia cowanii |
| 67 | 485031 | 485306 | + | NZ_CP050508.1 | Raoultella terrigena |
| 68 | 516989 | 517264 | + | NC_017554.1 | Pantoea ananatis PA13 |
| 69 | 2379202 | 2379486 | - | NZ_CP049115.1 | Pantoea stewartii |
| 70 | 561654 | 561938 | + | NZ_CP006569.1 | Sodalis praecaptivus |
| 71 | 412752 | 413024 | + | NZ_CP012257.1 | Cronobacter universalis NCTC 9529 |
| 72 | 482895 | 483161 | + | NZ_LN907827.1 | Erwinia gerundensis |
| 73 | 3897797 | 3898096 | - | NZ_CP016948.1 | Serratia surfactantfaciens |
| 74 | 4786595 | 4786855 | - | NZ_LR134494.1 | Serratia quinivorans |
| 75 | 4681456 | 4681755 | - | NZ_CP038662.1 | Serratia nematodiphila |
| 76 | 4642843 | 4643103 | - | NZ_LT906479.1 | Serratia ficaria |
| 77 | 508304 | 508564 | + | NZ_CP071320.1 | Serratia ureilytica |
| 78 | 4735614 | 4735913 | - | NZ_CP048784.1 | Serratia liquefaciens |
| 79 | 331409 | 331666 | + | NZ_CP046293.1 | Yersinia intermedia |
| 80 | 1134156 | 1134455 | - | NZ_CP011254.1 | Serratia fonticola |
| 81 | 4847815 | 4848075 | - | NC_015567.1 | Serratia plymuthica AS9 |
| 82 | 4255106 | 4255363 | - | NZ_CP032487.1 | Yersinia hibernica |
| 83 | 4193394 | 4193651 | - | NZ_CP043727.1 | Yersinia canariae |
| 84 | 1784757 | 1785014 | - | NZ_CP011078.1 | Yersinia ruckeri |
| 85 | 708215 | 708472 | - | NZ_CP054043.1 | Yersinia mollaretii ATCC 43969 |
| 86 | 2467998 | 2468255 | - | NZ_CP009787.1 | Yersinia rohdei |
| 87 | 495471 | 495728 | + | NZ_CP011118.1 | Yersinia enterocolitica |
| 88 | 485573 | 485845 | + | NZ_LR134373.1 | Yersinia pseudotuberculosis |
| 89 | 1537449 | 1537748 | + | NZ_CP007044.2 | Chania multitudinisentens RB-25 |
| 90 | 1161941 | 1162219 | - | NZ_CP006664.1 | Edwardsiella anguillarum ET080813 |
| 91 | 2229418 | 2229675 | - | NZ_CP009781.1 | Yersinia aldovae 670-83 |
| 92 | 1066417 | 1066698 | - | NZ_CP007230.1 | Yersinia similis |
| 93 | 971682 | 971981 | - | NZ_CP065640.1 | Serratia rubidaea |
| 94 | 3226582 | 3226878 | + | NZ_CP014136.1 | Gibbsiella quercinecans |
| 95 | 3778379 | 3778645 | + | NZ_CP016176.1 | Xenorhabdus hominickii |
| 96 | 3942258 | 3942536 | - | NZ_CP050150.1 | Hafnia alvei |
| 97 | 3271227 | 3271505 | - | NC_012779.2 | Edwardsiella ictaluri 93-146 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_LT556085.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02866.20 | 0.68 | 65 | 1946.5 | same-strand | lactate/malate dehydrogenase, alpha/beta C-terminal domain |
| 2 | PF00056.25 | 0.68 | 65 | 1946.5 | same-strand | lactate/malate dehydrogenase, NAD binding domain |
| 3 | PF01316.23 | 0.72 | 69 | 1071.5 | opposite-strand | Arginine repressor, DNA binding domain |
| 4 | PF02863.20 | 0.72 | 69 | 1071.5 | opposite-strand | Arginine repressor, C-terminal domain |
| 5 | PF07338.15 | 0.72 | 69 | 301 | opposite-strand | Protein of unknown function (DUF1471) |
| 6 | PF04632.14 | 0.95 | 91 | 1584.0 | same-strand | Fusaric acid resistance protein family |
| 7 | PF13515.8 | 0.95 | 91 | 1584.0 | same-strand | Fusaric acid resistance protein-like |
| 8 | PF13533.8 | 0.95 | 91 | 3557.0 | same-strand | Biotin-lipoyl like |
| 9 | PF16576.7 | 0.95 | 91 | 3557.0 | same-strand | Barrel-sandwich domain of CusB or HlyD membrane-fusion |
| 10 | PF13437.8 | 0.91 | 87 | 3557.0 | same-strand | HlyD family secretion protein |
| 11 | PF00529.22 | 0.95 | 91 | 3557.0 | same-strand | Cation efflux system protein CusB domain 1 |
| 12 | PF07869.14 | 0.94 | 90 | 4497 | same-strand | Protein of unknown function (DUF1656) |
| 13 | PF03466.22 | 0.85 | 82 | 4873 | opposite-strand | LysR substrate binding domain |
| 14 | PF00126.29 | 0.85 | 82 | 4873 | opposite-strand | Bacterial regulatory helix-turn-helix protein, lysR family |
| 15 | PF00171.24 | 0.62 | 60 | 46.0 | same-strand | Aldehyde dehydrogenase family |
++ More..