Result : P64602
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Intermembrane phospholipid transport system binding protein MlaB |
| NCBI Accession ID | U00096.3 |
| Organism | Escherichia coli (strain K12) |
| Left | 3336963 |
| Right | 3337256 |
| Strand | - |
| Nucleotide Sequence | ATGAGCGAGTCACTGAGCTGGATGCAGACGGGTGACACGCTGGCGTTATCCGGAGAGCTGGATCAGGACGTTTTGCTACCGCTTTGGGAAATGCGTGAGGAAGCGGTGAAGGGGATTACCTGCATCGATCTTAGCCGTGTCTCCCGCGTGGATACGGGGGGACTGGCACTGCTGCTCCATCTTATCGATCTGGCGAAAAAGCAGGGCAACAATGTGACGCTTCAGGGGGTAAACGACAAAGTGTATACCCTGGCGAAATTGTATAATTTGCCTGCTGATGTTCTGCCTCGTTAA |
| Sequence | MSESLSWMQTGDTLALSGELDQDVLLPLWEMREEAVKGITCIDLSRVSRVDTGGLALLLHLIDLAKKQGNNVTLQGVNDKVYTLAKLYNLPADVLPR |
| Source of smORF | Swiss-Prot |
| Function | Part of the ABC transporter complex MlaFEDB, which is involved in a phospholipid transport pathway that maintains lipid asymmetry in the outer membrane by retrograde trafficking of phospholipids from the outer membrane to the inner membrane (Pubmed:19383799, Pubmed:27529189). MlaB plays critical roles in both the assembly and activity of the complex. May act by modulating MlaF structure and stability (Pubmed:27529189). {ECO:0000269|Pubmed:19383799, ECO:0000269|Pubmed:27529189}. |
| Pubmed ID | 9278503 16738553 19383799 27529189 28388411 |
| Domain | CDD:412468 |
| Functional Category | Others |
| Uniprot ID | P64602 |
| ORF Length (Amino Acid) | 97 |
++ More..
| Conservation Analysis |
No. of Species: 58
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 479605 | 479898 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 2 | 3329143 | 3329436 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 3 | 3336963 | 3337256 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 4 | 4079444 | 4079737 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 5 | 3320521 | 3320814 | - | NZ_AP014857.1 | Escherichia albertii |
| 6 | 3842116 | 3842409 | - | NZ_LR134340.1 | Escherichia marmotae |
| 7 | 2261618 | 2261911 | - | NZ_CP057657.1 | Escherichia fergusonii |
| 8 | 5359944 | 5360240 | - | NZ_CP045205.1 | Citrobacter telavivensis |
| 9 | 4240311 | 4240604 | - | NC_009792.1 | Citrobacter koseri ATCC BAA-895 |
| 10 | 4883178 | 4883474 | + | NC_013716.1 | Citrobacter rodentium ICC168 |
| 11 | 1765292 | 1765588 | + | NZ_LT556085.1 | Citrobacter amalonaticus |
| 12 | 3936619 | 3936912 | + | NZ_CP038469.1 | Citrobacter tructae |
| 13 | 2938591 | 2938884 | + | NZ_CP044098.1 | Citrobacter portucalensis |
| 14 | 2142596 | 2142889 | - | NZ_CP033744.1 | Citrobacter freundii |
| 15 | 1331576 | 1331869 | - | NZ_CP053416.1 | Salmonella bongori |
| 16 | 3476657 | 3476953 | - | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
| 17 | 4170944 | 4171237 | - | NC_015968.1 | Enterobacter soli |
| 18 | 4513963 | 4514256 | - | NZ_CP043318.1 | Enterobacter chengduensis |
| 19 | 4173947 | 4174240 | - | NZ_CP017184.1 | Enterobacter roggenkampii |
| 20 | 3131118 | 3131411 | + | NZ_CP025034.2 | Enterobacter sp. SGAir0187 |
| 21 | 4228093 | 4228386 | + | NZ_CP017279.1 | Enterobacter ludwigii |
| 22 | 4279915 | 4280208 | - | NZ_CP009756.1 | Enterobacter cloacae |
| 23 | 4160063 | 4160356 | - | NZ_CP027986.1 | Enterobacter sichuanensis |
| 24 | 4084978 | 4085271 | - | NZ_AP022508.1 | Enterobacter bugandensis |
| 25 | 5249537 | 5249830 | + | NZ_CP011602.1 | Phytobacter ursingii |
| 26 | 2599632 | 2599925 | - | NZ_CP016337.1 | Kosakonia sacchari |
| 27 | 1909024 | 1909317 | - | NZ_AP019007.1 | Enterobacter oligotrophicus |
| 28 | 1086759 | 1087052 | + | NZ_CP051548.1 | Phytobacter diazotrophicus |
| 29 | 2876489 | 2876782 | - | NZ_CP023529.1 | Lelliottia amnigena |
| 30 | 4777083 | 4777376 | - | NZ_CP015113.1 | Kosakonia radicincitans |
| 31 | 506080 | 506373 | + | NZ_CP035129.1 | Kosakonia cowanii |
| 32 | 3652739 | 3653032 | + | NZ_CP045300.1 | Kosakonia arachidis |
| 33 | 546889 | 547182 | + | NZ_CP014007.2 | Kosakonia oryzae |
| 34 | 4177424 | 4177717 | + | NZ_CP045769.1 | Enterobacter cancerogenus |
| 35 | 4349699 | 4349992 | - | NZ_CP063425.1 | Kosakonia pseudosacchari |
| 36 | 566559 | 566852 | + | NZ_CP013990.1 | Leclercia adecarboxylata |
| 37 | 613606 | 613896 | + | NZ_CP060111.1 | Klebsiella michiganensis |
| 38 | 557492 | 557782 | + | NZ_CP045845.1 | Kluyvera intermedia |
| 39 | 511656 | 511946 | + | NZ_CP041247.1 | Raoultella electrica |
| 40 | 561968 | 562258 | + | NZ_CP046672.1 | Raoultella ornithinolytica |
| 41 | 1161154 | 1161444 | - | NZ_CP026047.1 | Raoultella planticola |
| 42 | 523871 | 524161 | + | NZ_CP065838.1 | Klebsiella quasipneumoniae |
| 43 | 520017 | 520307 | + | NZ_LR134475.1 | Klebsiella aerogenes |
| 44 | 652228 | 652518 | + | NZ_CP036175.1 | Klebsiella huaxiensis |
| 45 | 530271 | 530561 | + | NZ_CP050508.1 | Raoultella terrigena |
| 46 | 537590 | 537880 | + | NZ_CP054254.1 | Klebsiella variicola |
| 47 | 4755849 | 4756139 | - | NC_016845.1 | Klebsiella pneumoniae subsp. pneumoniae HS11286 |
| 48 | 497600 | 497890 | + | NZ_CP054058.1 | Scandinavium goeteborgense |
| 49 | 1140570 | 1140872 | - | NZ_CP042941.1 | Atlantibacter hermannii |
| 50 | 334733 | 335035 | + | NZ_LR134201.1 | Cedecea lapagei |
| 51 | 498294 | 498596 | + | NZ_AP023184.1 | Buttiauxella agrestis |
| 52 | 331500 | 331802 | + | NZ_CP023525.1 | Cedecea neteri |
| 53 | 336212 | 336499 | - | NZ_CP020388.1 | Pluralibacter gergoviae |
| 54 | 463789 | 464091 | + | NZ_CP012264.1 | Cronobacter condimenti 1330 |
| 55 | 204717 | 205007 | + | NZ_CP015581.1 | Tatumella citrea |
| 56 | 3336932 | 3337228 | + | NZ_CP049115.1 | Pantoea stewartii |
| 57 | 3578069 | 3578371 | - | NZ_CP012268.1 | Cronobacter muytjensii ATCC 51329 |
| 58 | 2978318 | 2978620 | - | NZ_CP027107.1 | Cronobacter sakazakii |
| 59 | 460711 | 461013 | + | NZ_CP012266.1 | Cronobacter dublinensis subsp. dublinensis LMG 23823 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP061527.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01699.26 | 0.98 | 57 | 3034.0 | opposite-strand | Sodium/calcium exchanger protein |
| 2 | PF00005.29 | 1.0 | 58 | 1998 | same-strand | ABC transporter |
| 3 | PF02405.18 | 1.0 | 58 | 1209 | same-strand | Permease MlaE |
| 4 | PF02470.22 | 1.0 | 58 | 654 | same-strand | MlaD protein |
| 5 | PF05494.14 | 1.0 | 58 | 0 | same-strand | MlaC protein |
| 6 | PF00275.22 | 1.0 | 58 | 437 | same-strand | EPSP synthase (3-phosphoshikimate 1-carboxyvinyltransferase) |
| 7 | PF13693.8 | 1.0 | 58 | 1760 | opposite-strand | Winged helix-turn-helix DNA-binding |
| 8 | PF00348.19 | 1.0 | 58 | 2270 | opposite-strand | Polyprenyl synthetase |
| 9 | PF00829.23 | 0.78 | 45 | 3498.0 | same-strand | Ribosomal prokaryotic L21 protein |
++ More..