Result : A5IZ66
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 30S ribosomal protein S16 |
| NCBI Accession ID | CU179680.1 |
| Organism | Mycoplasma agalactiae (strain PG2) |
| Left | 742628 |
| Right | 742918 |
| Strand | + |
| Nucleotide Sequence | ATGGTTAAAATTAGACTTAAACGTCTAGGAAGCAAGTTTAACGCTTGCTACAAAATTGTAGTAGCAGATGCTCGTGCTCCACGTGATGGAAGATTTATAGAAGCTATTGGTGAATACAACCCTCACTCAAAAGCTCTTAGAATCAATGAAGAAGCTGCTATTCAATGAATTAAAAATGGTGCACAACTAACACAAACTGTTTACAACCTTTTCAAAACTCAAAAACTTAACGAAAAAATCAATTCTGTACTAAAAAGTGAAAAAGTTGCTGCTAAACAAGCATCAAAATAA |
| Sequence | MVKIRLKRLGSKFNACYKIVVADARAPRDGRFIEAIGEYNPHSKALRINEEAAIQWIKNGAQLTQTVYNLFKTQKLNEKINSVLKSEKVAAKQASK |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl00368. Profile Description: Ribosomal protein S16. This model describes ribosomal S16 of bacteria and organelles. [Protein synthesis, Ribosomal proteins: synthesis and modification] |
| Pubmed ID | 17511520 |
| Domain | CDD:412339 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | A5IZ66 |
| ORF Length (Amino Acid) | 96 |
++ More..
| Conservation Analysis |
No. of Species: 178
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 139509 | 139754 | + | NZ_CP009709.1 | Weizmannia coagulans DSM 1 = ATCC 7050 |
| 2 | 1403969 | 1404226 | - | NC_008593.1 | Clostridium novyi NT |
| 3 | 2567570 | 2567815 | - | NZ_CP018866.1 | Sutcliffiella cohnii |
| 4 | 2586248 | 2586493 | - | NZ_CP024109.1 | Bacillus cytotoxicus |
| 5 | 2171952 | 2172197 | + | NZ_CP053989.1 | Niallia circulans |
| 6 | 1501319 | 1501564 | + | NZ_CP040336.1 | Bacillus luti |
| 7 | 3658378 | 3658623 | - | NC_007530.2 | Bacillus anthracis str. 'Ames Ancestor' |
| 8 | 3727923 | 3728168 | - | NZ_CP064875.1 | Bacillus toyonensis |
| 9 | 3862973 | 3863218 | - | NC_011725.1 | Bacillus cereus B4264 |
| 10 | 3867215 | 3867460 | - | NZ_CP032365.1 | Bacillus wiedmannii |
| 11 | 1185883 | 1186128 | + | NZ_CP020953.1 | Clostridium drakei |
| 12 | 147156 | 147401 | + | NZ_CP011803.1 | Clostridium carboxidivorans P7 |
| 13 | 2332271 | 2332516 | - | NZ_CP011937.1 | Bacillus velezensis |
| 14 | 1628630 | 1628875 | + | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 15 | 3397907 | 3398152 | - | NZ_CP017703.1 | Aeribacillus pallidus |
| 16 | 2573814 | 2574059 | - | NZ_CP065425.1 | Heyndrickxia vini |
| 17 | 124028 | 124273 | - | NZ_CP017786.1 | Bacillus xiamenensis |
| 18 | 1575194 | 1575439 | + | NZ_CP011150.1 | Bacillus altitudinis |
| 19 | 3743746 | 3743991 | - | NZ_CP043404.1 | Bacillus safensis |
| 20 | 959899 | 960144 | - | NZ_CP017704.1 | Peribacillus simplex NBRC 15720 = DSM 1321 |
| 21 | 617995 | 618240 | + | NZ_CP064060.1 | Anoxybacillus caldiproteolyticus |
| 22 | 1852009 | 1852254 | + | NZ_CP033052.1 | Bacillus vallismortis |
| 23 | 1677767 | 1678012 | + | NZ_CP051464.1 | Bacillus mojavensis |
| 24 | 1641447 | 1641692 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 25 | 1646518 | 1646763 | + | NZ_CP013984.1 | Bacillus inaquosorum |
| 26 | 312234 | 312479 | - | NZ_CP029364.1 | Bacillus halotolerans |
| 27 | 1673647 | 1673892 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 28 | 4232745 | 4232990 | + | NZ_CP030926.1 | Peribacillus butanolivorans |
| 29 | 1807274 | 1807513 | - | NZ_CP014170.1 | Clostridium tyrobutyricum |
| 30 | 551905 | 552147 | + | NZ_CP016379.1 | Anoxybacter fermentans |
| 31 | 1039972 | 1040217 | + | NZ_CP012152.1 | Anoxybacillus gonensis |
| 32 | 1415295 | 1415531 | - | NZ_CP023434.1 | Suicoccus acidiformans |
| 33 | 712951 | 713199 | - | NZ_CP065729.1 | Macrococcus caseolyticus |
| 34 | 1581329 | 1581574 | + | NZ_CP048852.1 | Bacillus tequilensis |
| 35 | 3082079 | 3082324 | - | NZ_CP009933.1 | Clostridium scatologenes |
| 36 | 1954699 | 1954965 | - | NZ_CP048104.1 | Kroppenstedtia pulmonis |
| 37 | 1431576 | 1431821 | + | NZ_CP015438.1 | Anoxybacillus amylolyticus |
| 38 | 2151016 | 2151261 | - | NZ_CP014342.1 | Geobacillus subterraneus |
| 39 | 2379027 | 2379272 | - | NZ_CP020559.1 | Clostridium formicaceticum |
| 40 | 1779009 | 1779254 | + | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 41 | 1708251 | 1708496 | + | NZ_AP017312.1 | Aneurinibacillus soli |
| 42 | 1801619 | 1801864 | + | NZ_CP023665.1 | Bacillus paralicheniformis |
| 43 | 1800980 | 1801225 | + | NZ_LT603683.1 | Bacillus glycinifermentans |
| 44 | 1103512 | 1103760 | + | NZ_CP054482.1 | Macrococcus bohemicus |
| 45 | 1047043 | 1047279 | + | NC_014377.1 | Thermosediminibacter oceani DSM 16646 |
| 46 | 1007644 | 1007892 | + | NZ_CP047361.1 | Macrococcus canis |
| 47 | 1180775 | 1181017 | + | NZ_CP035130.1 | Gudongella oleilytica |
| 48 | 558896 | 559171 | - | NZ_CP014022.1 | Staphylococcus lugdunensis |
| 49 | 3027549 | 3027794 | + | NZ_CP015108.1 | Sporosarcina ureae |
| 50 | 2129679 | 2129924 | - | NZ_CP009687.1 | Clostridium aceticum |
| 51 | 2671239 | 2671511 | - | NZ_LS483476.1 | Lederbergia lentus |
| 52 | 149719 | 149964 | - | NZ_CP022983.1 | Cytobacillus kochii |
| 53 | 1193246 | 1193503 | + | NZ_CP032416.1 | Clostridium fermenticellae |
| 54 | 302035 | 302277 | - | NZ_CP017269.1 | Geosporobacter ferrireducens |
| 55 | 613475 | 613741 | + | NC_019978.1 | Halobacteroides halobius DSM 5150 |
| 56 | 1764120 | 1764365 | + | NC_022524.1 | Bacillus infantis NRRL B-14911 |
| 57 | 1573969 | 1574214 | + | NC_009922.1 | Alkaliphilus oremlandii OhILAs |
| 58 | 1537934 | 1538209 | - | NZ_LT906462.1 | Mammaliicoccus stepanovicii |
| 59 | 1659230 | 1659475 | + | NZ_CP015378.1 | Fictibacillus phosphorivorans |
| 60 | 1472664 | 1472921 | - | NC_014410.1 | Thermoanaerobacterium thermosaccharolyticum DSM 571 |
| 61 | 1604715 | 1604963 | - | NZ_CP040676.1 | Exiguobacterium mexicanum |
| 62 | 2789376 | 2789621 | - | NZ_CP070511.1 | Parageobacillus toebii |
| 63 | 1802554 | 1802799 | + | NZ_CP016622.1 | Parageobacillus thermoglucosidasius |
| 64 | 1055240 | 1055497 | + | NZ_LT906477.1 | Clostridium cochlearium |
| 65 | 1604661 | 1604936 | - | NZ_LR134242.1 | Staphylococcus warneri |
| 66 | 2375974 | 2376249 | + | NC_022737.1 | Staphylococcus pasteuri SP1 |
| 67 | 4965660 | 4965905 | - | NZ_CP041305.1 | Cytobacillus ciccensis |
| 68 | 724650 | 724910 | + | NZ_CP013988.1 | Aerococcus urinaeequi |
| 69 | 1084351 | 1084617 | + | NZ_CP013114.1 | Staphylococcus equorum |
| 70 | 2763568 | 2763813 | - | NZ_CP018058.1 | Geobacillus thermocatenulatus |
| 71 | 691678 | 691953 | + | NZ_CP068061.1 | Mammaliicoccus vitulinus |
| 72 | 1460327 | 1460602 | - | NZ_CP022046.2 | Mammaliicoccus sciuri |
| 73 | 2371951 | 2372196 | - | NZ_CP016020.1 | Bacillus weihaiensis |
| 74 | 2066730 | 2066975 | + | NZ_CP042593.1 | Bacillus dafuensis |
| 75 | 1467169 | 1467414 | + | NZ_CP031223.1 | Psychrobacillus glaciei |
| 76 | 1984689 | 1984955 | + | NZ_CP049740.1 | Jeotgalibaca arthritidis |
| 77 | 1406070 | 1406327 | - | NC_015555.1 | Thermoanaerobacterium xylanolyticum LX-11 |
| 78 | 1482970 | 1483227 | - | NZ_CP047602.1 | Thermoanaerobacterium aotearoense |
| 79 | 2165528 | 2165794 | - | NZ_CP048103.1 | Kroppenstedtia eburnea |
| 80 | 388238 | 388483 | + | NZ_CP023501.1 | Weissella paramesenteroides |
| 81 | 1461538 | 1461804 | - | NZ_CP065712.1 | Staphylococcus auricularis |
| 82 | 1185586 | 1185861 | + | NZ_LT906460.1 | Staphylococcus simiae |
| 83 | 1442448 | 1442705 | + | NC_011837.1 | Clostridium kluyveri NBRC 12016 |
| 84 | 1050810 | 1051055 | + | NZ_CP006837.1 | Lysinibacillus varians |
| 85 | 3619485 | 3619730 | - | NZ_CP019980.1 | Lysinibacillus sphaericus |
| 86 | 2486767 | 2487012 | + | NZ_CP034465.1 | Jeotgalibaca ciconiae |
| 87 | 2931751 | 2931996 | - | NZ_CP022657.1 | Tumebacillus algifaecis |
| 88 | 2045521 | 2045766 | - | NZ_CP038015.1 | Paenisporosarcina antarctica |
| 89 | 3434205 | 3434450 | + | NZ_CP021434.1 | Tumebacillus avium |
| 90 | 508985 | 509230 | + | NZ_CP014161.1 | Aerococcus urinae |
| 91 | 2341193 | 2341438 | - | NC_013791.2 | Alkalihalobacillus pseudofirmus OF4 |
| 92 | 1553898 | 1554146 | - | NC_014334.2 | Lacticaseibacillus paracasei |
| 93 | 1532051 | 1532299 | - | NZ_AP012544.1 | Lacticaseibacillus casei DSM 20011 = JCM 1134 = ATCC 393 |
| 94 | 1536516 | 1536764 | - | NZ_LS991421.1 | Lacticaseibacillus zeae |
| 95 | 3277285 | 3277530 | - | NZ_CP014616.1 | Sporosarcina psychrophila |
| 96 | 1219096 | 1219341 | + | NC_006510.1 | Geobacillus kaustophilus HTA426 |
| 97 | 304954 | 305199 | + | NZ_CP061470.1 | Geobacillus zalihae |
| 98 | 666948 | 667193 | + | NZ_CP061472.1 | Geobacillus thermoleovorans |
| 99 | 3743988 | 3744233 | - | NZ_CP010820.1 | Lysinibacillus fusiformis |
| 100 | 3267210 | 3267455 | - | NZ_CP022315.1 | Virgibacillus phasianinus |
| 101 | 582889 | 583134 | + | NZ_CP019728.1 | Jeotgalibaca dankookensis |
| 102 | 1669993 | 1670238 | + | NZ_CP023704.1 | Caldibacillus thermoamylovorans |
| 103 | 541258 | 541533 | + | NZ_CP007601.1 | Staphylococcus capitis subsp. capitis |
| 104 | 2599668 | 2599913 | + | NZ_CP026363.1 | Brevibacillus agri |
| 105 | 34052 | 34288 | - | NZ_CP053988.1 | Abiotrophia defectiva |
| 106 | 1352827 | 1353072 | + | NZ_CP012024.1 | Bacillus smithii |
| 107 | 3907137 | 3907388 | - | NZ_CP018622.1 | Virgibacillus dokdonensis |
| 108 | 1857095 | 1857343 | - | NC_010556.1 | Exiguobacterium sibiricum 255-15 |
| 109 | 1577708 | 1577953 | + | NC_004193.1 | Oceanobacillus iheyensis HTE831 |
| 110 | 917265 | 917531 | - | NZ_CP018199.1 | Staphylococcus succinus |
| 111 | 192551 | 192817 | + | NZ_CP022096.2 | Staphylococcus pettenkoferi |
| 112 | 1159735 | 1160010 | + | NC_007795.1 | Staphylococcus aureus subsp. aureus NCTC 8325 |
| 113 | 1230265 | 1230540 | + | NZ_LR134304.1 | Staphylococcus schweitzeri |
| 114 | 1704919 | 1705185 | - | NZ_CP008724.1 | Staphylococcus xylosus |
| 115 | 1457664 | 1457942 | - | NC_016630.1 | Filifactor alocis ATCC 35896 |
| 116 | 822000 | 822245 | + | NC_011898.1 | Ruminiclostridium cellulolyticum H10 |
| 117 | 1789139 | 1789384 | - | NZ_CP038012.1 | Sporosarcina pasteurii |
| 118 | 2540574 | 2540819 | - | NZ_CP017560.1 | Sporosarcina ureilytica |
| 119 | 1688663 | 1688908 | - | NZ_CP014204.2 | Clostridium baratii |
| 120 | 2569073 | 2569318 | - | NZ_CP022437.1 | Virgibacillus necropolis |
| 121 | 96266 | 96523 | + | NZ_CP030140.1 | Mycoplasma anseris |
| 122 | 2388284 | 2388529 | + | NZ_LR134338.1 | Brevibacillus brevis |
| 123 | 3401325 | 3401570 | + | NZ_CP063356.1 | Anaerobacillus isosaccharinicus |
| 124 | 747055 | 747300 | + | NZ_CP027563.1 | Weissella confusa |
| 125 | 1628912 | 1629178 | - | NZ_CP064056.1 | Staphylococcus lloydii |
| 126 | 1573197 | 1573466 | - | NZ_CP034118.1 | Staphylospora marina |
| 127 | 3716 | 3976 | - | NZ_AP014657.1 | Mycoplasmopsis arginini |
| 128 | 1712062 | 1712337 | + | NZ_CP066042.1 | Staphylococcus saccharolyticus |
| 129 | 2093043 | 2093285 | - | NZ_CP017962.1 | Virgibacillus halodenitrificans |
| 130 | 1502814 | 1503062 | - | NZ_CP018180.1 | Liquorilactobacillus nagelii |
| 131 | 2600807 | 2601052 | - | NC_002570.2 | Alkalihalobacillus halodurans C-125 |
| 132 | 73251 | 73496 | - | NZ_CP067016.1 | Anaerococcus obesiensis |
| 133 | 1421220 | 1421465 | + | NZ_AP021853.1 | Sporolactobacillus terrae |
| 134 | 1056413 | 1056664 | + | NC_018870.1 | Thermacetogenium phaeum DSM 12270 |
| 135 | 1166788 | 1167033 | - | NZ_CP016786.1 | Clostridium isatidis |
| 136 | 2700641 | 2700886 | - | NZ_CP019870.1 | Clostridioides difficile |
| 137 | 884508 | 884777 | - | NZ_AP019711.1 | Amedibacterium intestinale |
| 138 | 821612 | 821851 | - | NZ_CP029256.1 | Christensenella minuta |
| 139 | 1218076 | 1218342 | + | NZ_CP039710.1 | Thermoactinomyces vulgaris |
| 140 | 4068091 | 4068336 | - | NZ_CP034346.1 | Paenibacillus lutimineralis |
| 141 | 652778 | 653023 | - | NZ_CP012034.1 | Companilactobacillus ginsenosidimutans |
| 142 | 948642 | 948887 | - | NZ_CP031092.1 | Salicibibacter kimchii |
| 143 | 370838 | 371077 | + | NZ_CP013862.1 | Lentibacillus amyloliquefaciens |
| 144 | 2890617 | 2890862 | - | NZ_CP014150.1 | Paeniclostridium sordellii |
| 145 | 2786382 | 2786645 | - | NC_021184.1 | Desulfoscipio gibsoniae DSM 7213 |
| 146 | 1442104 | 1442340 | + | NC_010718.1 | Natranaerobius thermophilus JW/NM-WN-LF |
| 147 | 1050387 | 1050632 | + | NZ_LR134483.1 | Listeria grayi |
| 148 | 1700403 | 1700702 | - | NC_018664.1 | Gottschalkia acidurici 9a |
| 149 | 1755081 | 1755326 | + | NZ_CP019323.1 | Companilactobacillus allii |
| 150 | 1665643 | 1665918 | - | NZ_CP035288.1 | Staphylococcus epidermidis |
| 151 | 1727420 | 1727695 | - | NZ_AP018587.1 | Staphylococcus caprae |
| 152 | 1276054 | 1276296 | + | NZ_AP019004.1 | Phascolarctobacterium faecium |
| 153 | 938183 | 938428 | - | NZ_CP035485.1 | Salicibibacter halophilus |
| 154 | 679720 | 679965 | + | NZ_CP044496.1 | Lactobacillus acetotolerans |
| 155 | 1040598 | 1040843 | + | NZ_CP014159.1 | Aerococcus christensenii |
| 156 | 378312 | 378557 | - | NZ_CP049889.1 | Jeotgalibaca porci |
| 157 | 1270074 | 1270346 | - | NZ_CP046314.1 | Gemella morbillorum |
| 158 | 932232 | 932504 | + | NZ_LR134484.1 | Gemella haemolysans |
| 159 | 1451801 | 1452061 | - | NZ_CP014164.1 | Aerococcus viridans |
| 160 | 1706881 | 1707123 | - | NC_014614.1 | Acetoanaerobium sticklandii |
| 161 | 2421074 | 2421316 | - | NZ_CP020772.1 | Halobacillus mangrovi |
| 162 | 2184520 | 2184759 | + | NC_010337.2 | Heliomicrobium modesticaldum Ice1 |
| 163 | 1545691 | 1545936 | + | NZ_CP009416.1 | Jeotgalibacillus malaysiensis |
| 164 | 1137960 | 1138205 | - | NZ_CP024610.1 | Lactobacillus terrae |
| 165 | 1219060 | 1219320 | + | NC_013216.1 | Desulfofarcimen acetoxidans DSM 771 |
| 166 | 1439280 | 1439525 | - | NZ_CP014332.1 | Weissella jogaejeotgali |
| 167 | 1825607 | 1825879 | - | NC_013891.1 | Listeria seeligeri serovar 1/2b str. SLCC3954 |
| 168 | 1841454 | 1841726 | - | NZ_LT906444.1 | Listeria welshimeri |
| 169 | 1922044 | 1922316 | - | NZ_CP009577.1 | Listeria ivanovii subsp. ivanovii |
| 170 | 1867427 | 1867699 | - | NC_003210.1 | Listeria monocytogenes EGD-e |
| 171 | 1794622 | 1794867 | + | NZ_CP024848.1 | Oceanobacillus zhaokaii |
| 172 | 2723118 | 2723363 | - | NC_014829.1 | Evansella cellulosilytica DSM 2522 |
| 173 | 765155 | 765400 | + | NZ_CP018809.1 | Lactobacillus jensenii |
| 174 | 550785 | 551030 | + | NC_013740.1 | Acidaminococcus fermentans DSM 20731 |
| 175 | 1173718 | 1173963 | - | NZ_AP019750.1 | Lactobacillus delbrueckii subsp. delbrueckii |
| 176 | 1794948 | 1795193 | - | NZ_AP022822.1 | Enterococcus saigonensis |
| 177 | 2496563 | 2496808 | - | NC_016894.1 | Acetobacterium woodii DSM 1030 |
| 178 | 403355 | 403603 | + | NC_014147.1 | Moraxella catarrhalis BBH18 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP009709.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02463.21 | 0.65 | 115 | 3020 | same-strand | RecF/RecN/SMC N terminal domain |
| 2 | PF06470.15 | 0.74 | 132 | 3063.0 | same-strand | SMC proteins Flexible Hinge Domain |
| 3 | PF00448.24 | 0.94 | 168 | 452.0 | same-strand | SRP54-type protein, GTPase domain |
| 4 | PF02881.21 | 0.94 | 168 | 452.0 | same-strand | SRP54-type protein, helical bundle domain |
| 5 | PF04297.16 | 0.91 | 162 | 1493.0 | same-strand | Putative helix-turn-helix protein, YlxM / p13 like |
| 6 | PF02978.21 | 0.94 | 168 | 127.5 | same-strand | Signal peptide binding domain |
| 7 | PF13083.8 | 0.81 | 144 | 15.5 | same-strand | KH domain |
| 8 | PF01782.20 | 0.96 | 171 | 434 | same-strand | RimM N-terminal domain |
| 9 | PF05239.18 | 0.96 | 171 | 434 | same-strand | PRC-barrel domain |
| 10 | PF01746.23 | 0.97 | 173 | 931 | same-strand | tRNA (Guanine-1)-methyltransferase |
| 11 | PF01245.22 | 0.88 | 156 | 1805.0 | same-strand | Ribosomal protein L19 |
++ More..