ProsmORF-pred
Result : P64577
Protein Information
Information Type Description
Protein name Uncharacterized protein YghW
NCBI Accession ID AE005674.2
Organism Shigella flexneri
Left 3141887
Right 3142174
Strand -
Nucleotide Sequence ATGAATAACCATTTTGGTAAAGGCTTAATGGCGGGATTAAAAGCAACGCATGCCGACAGTGCGGTTAATGTGACAAAATTCTGTGCCGATTATAAACGCGGTTTTGTATTAGGCTACTCACACAGGATGTACGAAAAGACCGGAGATCGCCAGCTTAGCGCCTGGGAAGCGGGTATTCTGACGCGCCGCTATGGACTGGATAAAGAGATGGTAATGGATTTCTTTCGTGAGAATAATTCCTGTTCTACGTTGCGCTTTTTTATGGCCGGTTATCGCCTCGAAAATTGA
Sequence MNNHFGKGLMAGLKATHADSAVNVTKFCADYKRGFVLGYSHRMYEKTGDRQLSAWEAGILTRRYGLDKEMVMDFFRENNSCSTLRFFMAGYRLEN
Source of smORF Swiss-Prot
Function The ORF matches to the profile of pfam11115. Profile Description: Protein of unknown function (DUF2623). This family is conserved in the Enterobacteriaceae family. Several members are named as YghW. The function is not known.
Pubmed ID 12384590 12704152
Domain CDD:371383
Functional Category Others
Uniprot ID P64577
ORF Length (Amino Acid) 95
++ More..
Conservation Analysis
Conservation Analysis
No. of Species: 40
Sr.No. Left Position Right Position Strand NCBI Accession id Species Name
1 756807 757094 - NZ_CP061527.1 Shigella dysenteriae
2 3664211 3664498 - NZ_LR134340.1 Escherichia marmotae
3 3141887 3142174 - NC_004337.2 Shigella flexneri 2a str. 301
4 3146450 3146737 - NC_000913.3 Escherichia coli str. K-12 substr. MG1655
5 3886931 3887218 - NC_002695.2 Escherichia coli O157:H7 str. Sakai
6 3126771 3127058 - NZ_AP014857.1 Escherichia albertii
7 2034027 2034314 - NZ_CP057657.1 Escherichia fergusonii
8 1997815 1998102 + NZ_LT556085.1 Citrobacter amalonaticus
9 5104921 5105208 - NZ_CP045205.1 Citrobacter telavivensis
10 4066161 4066448 - NC_009792.1 Citrobacter koseri ATCC BAA-895
11 879081 879368 + NZ_CP036175.1 Klebsiella huaxiensis
12 1924888 1925175 - NZ_CP033744.1 Citrobacter freundii
13 3167769 3168056 + NZ_CP044098.1 Citrobacter portucalensis
14 3854998 3855285 - NZ_CP012871.1 [Enterobacter] lignolyticus
15 4170033 4170320 + NZ_CP038469.1 Citrobacter tructae
16 4565737 4566024 - NZ_CP015113.1 Kosakonia radicincitans
17 726280 726567 + NZ_CP014007.2 Kosakonia oryzae
18 3858092 3858379 + NZ_CP016337.1 Kosakonia sacchari
19 4147214 4147501 - NZ_CP063425.1 Kosakonia pseudosacchari
20 3820660 3820947 + NZ_CP045300.1 Kosakonia arachidis
21 676258 676545 + NZ_CP041247.1 Raoultella electrica
22 728391 728678 + NZ_CP046672.1 Raoultella ornithinolytica
23 1296429 1296716 + NZ_CP051548.1 Phytobacter diazotrophicus
24 732319 732609 + NZ_CP045845.1 Kluyvera intermedia
25 995955 996242 - NZ_CP026047.1 Raoultella planticola
26 718665 718952 + NZ_CP065838.1 Klebsiella quasipneumoniae
27 5464908 5465195 + NZ_CP011602.1 Phytobacter ursingii
28 3940335 3940622 - NC_015968.1 Enterobacter soli
29 1676708 1676995 - NZ_AP019007.1 Enterobacter oligotrophicus
30 1171639 1171926 - NZ_CP053416.1 Salmonella bongori
31 4405459 4405746 + NZ_CP045769.1 Enterobacter cancerogenus
32 742609 742896 + NZ_CP054254.1 Klebsiella variicola
33 2645039 2645326 - NZ_CP023529.1 Lelliottia amnigena
34 4572440 4572727 - NC_016845.1 Klebsiella pneumoniae subsp. pneumoniae HS11286
35 3313959 3314246 - NC_003197.2 Salmonella enterica subsp. enterica serovar Typhimurium str. LT2
36 823519 823806 + NZ_CP023525.1 Cedecea neteri
37 821714 822001 + NZ_LR134201.1 Cedecea lapagei
38 2009676 2009969 + NZ_CP042941.1 Atlantibacter hermannii
39 3401183 3401476 - NZ_LT906479.1 Serratia ficaria
40 3467132 3467419 - NZ_LR134494.1 Serratia quinivorans
41 3418018 3418305 - NZ_CP048784.1 Serratia liquefaciens
++ More..
Neighborhood Conservation Analysis
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Conservation Analysis
Neighborhood Representative Chosen(Species): NZ_LR134340.1
Sr.No. Domain Co-occurrence Frequency No. of species in which domain occurs with smORF Median distance b/w smORF and domain bearing ORFs Orientation relative to smORF PFAM Information
1 PF01738.20 0.65 26 1808.5 same-strand Dienelactone hydrolase family
2 PF00248.23 0.68 27 2834.0 opposite-strand Aldo/keto reductase family
3 PF03350.18 0.6 24 2243 same-strand Uncharacterized protein family, UPF0114
++ More..