Result : P64570
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Protein YqgC |
| NCBI Accession ID | U28377.1 |
| Organism | Escherichia coli (strain K12) |
| Left | 40582 |
| Right | 40797 |
| Strand | + |
| Nucleotide Sequence | ATGGGTATAACATCGGCAGGTATGCAAAGCAGAGATGCAGAGTGCGGGGAACGAATCTTCACCAGAACGGTGAGACAGGTTAAGCAGCAGACAACGGTTCATTATTTCGTATCACCTCCACGGCCGCCTGTTAAGACGAACCCACAAGCCAAAACTCTGATTTCAACCCGGCTGGAAGTGGCAACACGAAAGAAACGTCGTGTGCTTTTTATTTAA |
| Sequence | MGITSAGMQSRDAECGERIFTRTVRQVKQQTTVHYFVSPPRPPVKTNPQAKTLISTRLEVATRKKRRVLFI |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 9278503 16738553 25561288 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | P64570 |
| ORF Length (Amino Acid) | 71 |
++ More..
| Conservation Analysis |
No. of Species: 6
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3086187 | 3086402 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 2 | 3827800 | 3828015 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 3 | 3024476 | 3024691 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 4 | 704616 | 704831 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 5 | 3027212 | 3027427 | + | NZ_AP014857.1 | Escherichia albertii |
| 6 | 3569774 | 3569989 | + | NZ_LR134340.1 | Escherichia marmotae |
| 7 | 3779960 | 3780157 | + | NZ_CP012871.1 | [Enterobacter] lignolyticus |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000913.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00491.23 | 0.83 | 5 | 3265.0 | opposite-strand | Arginase family |
| 2 | PF02784.18 | 1.0 | 6 | 276 | opposite-strand | Pyridoxal-dependent decarboxylase, pyridoxal binding domain |
| 3 | PF17810.3 | 1.0 | 6 | 276 | opposite-strand | Arginine decarboxylase helical bundle domain |
| 4 | PF17944.3 | 1.0 | 6 | 276 | opposite-strand | Arginine decarboxylase C-terminal helical extension |
| 5 | PF02773.18 | 1.0 | 6 | 304 | same-strand | S-adenosylmethionine synthetase, C-terminal domain |
| 6 | PF02772.18 | 1.0 | 6 | 304 | same-strand | S-adenosylmethionine synthetase, central domain |
| 7 | PF00438.22 | 1.0 | 6 | 304 | same-strand | S-adenosylmethionine synthetase, N-terminal domain |
| 8 | PF00083.26 | 1.0 | 6 | 1895 | same-strand | Sugar (and other) transporter |
| 9 | PF10263.11 | 0.67 | 4 | 3408 | same-strand | SprT-like family |
| 10 | PF17283.4 | 1.0 | 6 | 3408 | same-strand | SprT-like zinc ribbon domain |
| 11 | PF04231.15 | 1.0 | 6 | 3958 | same-strand | Endonuclease I |
++ More..