Protein Information |
Information Type | Description |
---|---|
Protein name | Uncharacterized protein YeiS |
NCBI Accession ID | U00096.3 |
Organism | Escherichia coli (strain K12) |
Left | 2233600 |
Right | 2233839 |
Strand | + |
Nucleotide Sequence | ATGGATGTACAGCAGTTTTTTGTCGTTGCCGTTTTTTTCCTTATCCCGATATTTTGTTTCCGCGAAGCATGGAAAGGCTGGCGCGCAGGCGCGATTGATAAACGGGTTAAAAATGCACCGGAACCGGTGTATGTCTGGCGAGCAAAAAATCCCGGACTCTTTTTCGCTTATATGGTGGCATATATCGGCTTCGGAATTTTATCTATCGGCATGATTGTTTATCTTATTTTCTATCGTTAA |
Sequence | MDVQQFFVVAVFFLIPIFCFREAWKGWRAGAIDKRVKNAPEPVYVWRAKNPGLFFAYMVAYIGFGILSIGMIVYLIFYR |
Source of smORF | Swiss-Prot |
Function | The ORF matches to the profile of pfam10808. Profile Description: Protein of unknown function (DUF2542). This family of proteins with unknown function appears to be restricted to Enterobacteriaceae. The family has a highly conserved sequence. |
Pubmed ID | 9278503 16738553 |
Domain | CDD:151258 |
Functional Category | Others |
Uniprot ID | P64536 |
ORF Length (Amino Acid) | 79 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 2256422 | 2256661 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
2 | 2233600 | 2233839 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
3 | 2968729 | 2968968 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
4 | 1658594 | 1658833 | + | NZ_CP061527.1 | Shigella dysenteriae |
5 | 1230732 | 1230971 | + | NZ_CP057657.1 | Escherichia fergusonii |
6 | 2243311 | 2243550 | + | NZ_AP014857.1 | Escherichia albertii |
7 | 2780396 | 2780635 | + | NZ_LR134340.1 | Escherichia marmotae |
8 | 303322 | 303561 | - | NZ_CP038469.1 | Citrobacter tructae |
9 | 948552 | 948791 | + | NZ_CP033744.1 | Citrobacter freundii |
10 | 2280947 | 2281186 | + | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
11 | 274599 | 274838 | + | NZ_CP053416.1 | Salmonella bongori |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF03788.16 | 1.0 | 10 | 2578 | same-strand | LrgA family |
2 | PF04172.18 | 1.0 | 10 | 1886 | same-strand | LrgB-like family |
3 | PF08211.14 | 1.0 | 10 | 872 | same-strand | Cytidine and deoxycytidylate deaminase zinc-binding region |
4 | PF02698.19 | 1.0 | 10 | 3 | same-strand | DUF218 domain |
5 | PF14691.8 | 1.0 | 10 | 205 | same-strand | Dihydroprymidine dehydrogenase domain II, 4Fe-4S cluster |
6 | PF07992.16 | 1.0 | 10 | 205 | same-strand | Pyridine nucleotide-disulphide oxidoreductase |
7 | PF00070.29 | 1.0 | 10 | 205 | same-strand | Pyridine nucleotide-disulphide oxidoreductase |
8 | PF14697.8 | 1.0 | 10 | 1469 | same-strand | 4Fe-4S dicluster domain |
9 | PF00037.29 | 0.6 | 6 | 1551 | same-strand | 4Fe-4S binding domain |
10 | PF12838.9 | 1.0 | 10 | 1469 | same-strand | 4Fe-4S dicluster domain |
11 | PF02653.18 | 1.0 | 10 | 2769 | opposite-strand | Branched-chain amino acid transport system / permease component |
12 | PF00005.29 | 0.9 | 9 | 3792.5 | opposite-strand | ABC transporter |
13 | PF01180.23 | 0.9 | 9 | 1454.5 | same-strand | Dihydroorotate dehydrogenase |
14 | PF13407.8 | 0.8 | 8 | 5430 | opposite-strand | Periplasmic binding protein domain |
15 | PF13377.8 | 0.8 | 8 | 5430 | opposite-strand | Periplasmic binding protein-like domain |