Result : P64522
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YeeT |
| NCBI Accession ID | AE014075.1 |
| Organism | Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) |
| Left | 2366321 |
| Right | 2366542 |
| Strand | + |
| Nucleotide Sequence | ATGAAAATTATCACCCGTGGTGAAGCCATGCGTATTCACCAACAACATCCGACATCCCGTCTTTTTCCGTTCTGTACCGGTAAATACCGCTGGCACGGCAGTGCTGAAGCGTATACCGGTCGTGAAGTGCAGGATATTCCCGGTGTGCTGGCCGTGTTTGCTGAACGCCGTAAGGACAGTTTTGGCCCGTATGTCCGACTGATGAGCGTCACCCTGAACTGA |
| Sequence | MKIITRGEAMRIHQQHPTSRLFPFCTGKYRWHGSAEAYTGREVQDIPGVLAVFAERRKDSFGPYVRLMSVTLN |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of pfam06174. Profile Description: Protein of unknown function (DUF987). Family of bacterial proteins that are related to the hypothetical protein yeeT. |
| Pubmed ID | 12471157 |
| Domain | CDD:368775 |
| Functional Category | Others |
| Uniprot ID | P64522 |
| ORF Length (Amino Acid) | 73 |
++ More..
| Conservation Analysis |
No. of Species: 27
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2076817 | 2077038 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 2 | 264026 | 264247 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 3 | 2776877 | 2777077 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 4 | 5221837 | 5222058 | - | NC_013716.1 | Citrobacter rodentium ICC168 |
| 5 | 2749460 | 2749681 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 6 | 1453893 | 1454114 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 7 | 3680974 | 3681195 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 8 | 2657084 | 2657305 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 9 | 3096388 | 3096609 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 10 | 1217341 | 1217562 | + | NZ_CP011602.1 | Phytobacter ursingii |
| 11 | 577388 | 577609 | + | NZ_CP012871.1 | [Enterobacter] lignolyticus |
| 12 | 4051402 | 4051623 | - | NZ_CP050150.1 | Hafnia alvei |
| 13 | 436256 | 436477 | + | NZ_CP023525.1 | Cedecea neteri |
| 14 | 2547416 | 2547637 | - | NZ_CP045300.1 | Kosakonia arachidis |
| 15 | 4317295 | 4317516 | - | NZ_CP045300.1 | Kosakonia arachidis |
| 16 | 1932488 | 1932709 | + | NZ_LT556085.1 | Citrobacter amalonaticus |
| 17 | 462747 | 462968 | - | NZ_LT556085.1 | Citrobacter amalonaticus |
| 18 | 2504023 | 2504244 | - | NZ_LT556085.1 | Citrobacter amalonaticus |
| 19 | 5176316 | 5176537 | - | NZ_CP045205.1 | Citrobacter telavivensis |
| 20 | 4602931 | 4603152 | - | NZ_CP045205.1 | Citrobacter telavivensis |
| 21 | 1214572 | 1214793 | + | NZ_CP045205.1 | Citrobacter telavivensis |
| 22 | 1135077 | 1135298 | - | NZ_CP043318.1 | Enterobacter chengduensis |
| 23 | 414839 | 415060 | - | NZ_CP043318.1 | Enterobacter chengduensis |
| 24 | 959898 | 960119 | + | NZ_CP026047.1 | Raoultella planticola |
| 25 | 4800260 | 4800481 | - | NZ_CP017279.1 | Enterobacter ludwigii |
| 26 | 4933691 | 4933912 | - | NZ_CP046672.1 | Raoultella ornithinolytica |
| 27 | 4684966 | 4685187 | - | NZ_LR134494.1 | Serratia quinivorans |
| 28 | 3215887 | 3216108 | + | NZ_CP013940.1 | Cronobacter malonaticus LMG 23826 |
| 29 | 5332538 | 5332759 | - | NZ_CP036175.1 | Klebsiella huaxiensis |
| 30 | 5663717 | 5663938 | + | NZ_CP036175.1 | Klebsiella huaxiensis |
| 31 | 1426845 | 1427066 | - | NZ_CP036175.1 | Klebsiella huaxiensis |
| 32 | 3887885 | 3888106 | + | NZ_CP015113.1 | Kosakonia radicincitans |
| 33 | 3364746 | 3364967 | + | NZ_CP012264.1 | Cronobacter condimenti 1330 |
| 34 | 984860 | 985081 | + | NZ_CP009756.1 | Enterobacter cloacae |
| 35 | 588194 | 588415 | + | NZ_CP009756.1 | Enterobacter cloacae |
| 36 | 1333462 | 1333683 | - | NZ_CP060111.1 | Klebsiella michiganensis |
| 37 | 1231603 | 1231824 | + | NZ_LT615367.1 | Dickeya aquatica |
| 38 | 651907 | 652128 | + | NZ_CP011118.1 | Yersinia enterocolitica |
| 39 | 2311081 | 2311302 | + | NZ_CP023529.1 | Lelliottia amnigena |
| 40 | 3267356 | 3267577 | + | NZ_CP061511.1 | Mixta calida |
| 41 | 1186083 | 1186304 | - | NZ_CP006569.1 | Sodalis praecaptivus |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_013716.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF04002.17 | 0.96 | 26 | 14 | same-strand | RadC-like JAB domain |
| 2 | PF06154.13 | 0.96 | 26 | 24.0 | same-strand | CbeA antitoxin, type IV, cytoskeleton bundling-enhancing factor A |
| 3 | PF06755.14 | 1.0 | 27 | 432 | same-strand | CbtA toxin of type IV toxin-antitoxin system |
| 4 | PF03230.15 | 0.85 | 23 | 512 | same-strand | Antirestriction protein |
| 5 | PF06067.13 | 0.78 | 21 | 1206.5 | same-strand | Domain of unknown function (DUF932) |
++ More..