Result : P64508
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Protein YobF |
| NCBI Accession ID | U00096.3 |
| Organism | Escherichia coli (strain K12) |
| Left | 1907448 |
| Right | 1907591 |
| Strand | - |
| Nucleotide Sequence | ATGTGTGGCATTTTCAGTAAAGAAGTCCTGAGTAAACACGTTGACGTTGAATACCGCTTCTCTGCCGAGCCTTATATTGGTGCCTCATGCAGTAATGTGTCAGTTTTATCTATGTTATGCCTGCGGGCGAAGAAAACAATCTAA |
| Sequence | MCGIFSKEVLSKHVDVEYRFSAEPYIGASCSNVSVLSMLCLRAKKTI |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of pfam10736. Profile Description: Protein of unknown function (DUF2627). This family of proteins with unknown function appears to be restricted to a family of Enterobacterial proteins. It has a highly conserved sequence. |
| Pubmed ID | 9278503 16738553 19121005 19734316 |
| Domain | CDD:119256 |
| Functional Category | Others |
| Uniprot ID | P64508 |
| ORF Length (Amino Acid) | 47 |
++ More..
| Conservation Analysis |
No. of Species: 52
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2509415 | 2509558 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 2 | 1907448 | 1907591 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 3 | 1441929 | 1442072 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 4 | 1811537 | 1811680 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 5 | 1935766 | 1935909 | - | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
| 6 | 1117747 | 1117890 | + | NC_009792.1 | Citrobacter koseri ATCC BAA-895 |
| 7 | 4446774 | 4446917 | - | NZ_CP053416.1 | Salmonella bongori |
| 8 | 1840362 | 1840505 | - | NZ_AP014857.1 | Escherichia albertii |
| 9 | 561314 | 561457 | - | NZ_CP033744.1 | Citrobacter freundii |
| 10 | 4522097 | 4522240 | + | NZ_CP044098.1 | Citrobacter portucalensis |
| 11 | 1366265 | 1366408 | - | NZ_CP038469.1 | Citrobacter tructae |
| 12 | 4152691 | 4152834 | - | NZ_LT556085.1 | Citrobacter amalonaticus |
| 13 | 238883 | 239026 | + | NZ_CP057657.1 | Escherichia fergusonii |
| 14 | 1918086 | 1918229 | + | NZ_AP023184.1 | Buttiauxella agrestis |
| 15 | 2789957 | 2790100 | + | NZ_CP045205.1 | Citrobacter telavivensis |
| 16 | 1902186 | 1902329 | + | NZ_CP023525.1 | Cedecea neteri |
| 17 | 1827988 | 1828131 | + | NZ_LR134201.1 | Cedecea lapagei |
| 18 | 1983855 | 1983998 | - | NC_013716.1 | Citrobacter rodentium ICC168 |
| 19 | 1823112 | 1823255 | + | NC_017910.1 | Shimwellia blattae DSM 4481 = NBRC 105725 |
| 20 | 2677808 | 2677924 | - | NZ_CP012871.1 | [Enterobacter] lignolyticus |
| 21 | 2065792 | 2065908 | + | NZ_CP046672.1 | Raoultella ornithinolytica |
| 22 | 5211574 | 5211690 | - | NZ_CP026047.1 | Raoultella planticola |
| 23 | 1991285 | 1991401 | + | NZ_CP041247.1 | Raoultella electrica |
| 24 | 4493122 | 4493253 | + | NZ_CP025034.2 | Enterobacter sp. SGAir0187 |
| 25 | 2797800 | 2797931 | - | NZ_CP017184.1 | Enterobacter roggenkampii |
| 26 | 2796752 | 2796883 | - | NZ_CP027986.1 | Enterobacter sichuanensis |
| 27 | 2774368 | 2774499 | - | NZ_AP022508.1 | Enterobacter bugandensis |
| 28 | 1800509 | 1800625 | + | NZ_CP054058.1 | Scandinavium goeteborgense |
| 29 | 2253027 | 2253143 | + | NZ_CP060111.1 | Klebsiella michiganensis |
| 30 | 2106168 | 2106284 | + | NZ_CP050508.1 | Raoultella terrigena |
| 31 | 2012946 | 2013062 | + | NZ_LR134475.1 | Klebsiella aerogenes |
| 32 | 4061181 | 4061351 | - | NZ_CP020388.1 | Pluralibacter gergoviae |
| 33 | 3092761 | 3092877 | - | NZ_CP048784.1 | Serratia liquefaciens |
| 34 | 3100275 | 3100391 | - | NZ_LR134494.1 | Serratia quinivorans |
| 35 | 687181 | 687297 | - | NZ_CP011078.1 | Yersinia ruckeri |
| 36 | 5043299 | 5043415 | + | NZ_CP014136.1 | Gibbsiella quercinecans |
| 37 | 5283919 | 5284035 | - | NZ_CP011254.1 | Serratia fonticola |
| 38 | 2105222 | 2105338 | + | NZ_CP071320.1 | Serratia ureilytica |
| 39 | 3019431 | 3019547 | - | NZ_LT906479.1 | Serratia ficaria |
| 40 | 4081177 | 4081293 | - | NZ_CP007044.2 | Chania multitudinisentens RB-25 |
| 41 | 2260723 | 2260839 | + | NC_012912.1 | Dickeya chrysanthemi Ech1591 |
| 42 | 2486992 | 2487108 | - | NZ_CP025799.1 | Dickeya zeae |
| 43 | 2495894 | 2496010 | - | NZ_CP031560.1 | Dickeya dianthicola |
| 44 | 4739466 | 4739582 | - | NZ_CP015137.1 | Dickeya solani IPO 2222 |
| 45 | 2569968 | 2570084 | - | NC_014500.1 | Dickeya dadantii 3937 |
| 46 | 195044 | 195160 | + | NZ_CP009460.1 | Dickeya fangzhongdai |
| 47 | 2479734 | 2479850 | - | NZ_LT615367.1 | Dickeya aquatica |
| 48 | 2406713 | 2406829 | - | NC_012880.1 | Musicola paradisiaca Ech703 |
| 49 | 4378158 | 4378277 | - | NZ_CP065640.1 | Serratia rubidaea |
| 50 | 2261337 | 2261453 | + | NZ_CP038498.1 | Pectobacterium punjabense |
| 51 | 1702531 | 1702647 | - | NZ_CP015749.1 | Pectobacterium parmentieri |
| 52 | 2527829 | 2527945 | - | NZ_CP051652.1 | Pectobacterium carotovorum |
| 53 | 4050448 | 4050564 | + | NZ_CP015750.1 | Pectobacterium wasabiae CFBP 3304 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_002695.2
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF06173.14 | 0.85 | 44 | 3953 | opposite-strand | Protein of unknown function (DUF986) |
| 2 | PF02659.17 | 0.96 | 50 | 2989 | opposite-strand | Putative manganese efflux pump |
| 3 | PF13649.8 | 0.88 | 46 | 2240 | same-strand | Methyltransferase domain |
| 4 | PF08241.14 | 0.9 | 47 | 2240.0 | same-strand | Methyltransferase domain |
| 5 | PF00313.24 | 0.98 | 51 | 40.0 | same-strand | 'Cold-shock' DNA-binding domain |
| 6 | PF13974.8 | 0.65 | 34 | 658 | same-strand | YebO-like protein |
++ More..