Result : P64501
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YebO |
| NCBI Accession ID | AE006468.2 |
| Organism | Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) |
| Left | 1936558 |
| Right | 1936845 |
| Strand | - |
| Nucleotide Sequence | ATGAACGACGTTTTAAACTCTGGTGCGTTTTCTCTTGCATCTTTAATAGTATCAATGGTGGTTCTGGTGGTGGGGCTGGCGCTCTGGTTCTTTGTCAACCGGGCAAGCTCCCGTGCCAACGAGCAGATAGAATTGCTCGAAGCGTTATTGGATCAACAGAAGCGGCAAAACGCGTTGTTACGTCGCCTTTGCGAAGCAAACGAACCAGAAAAAGAAGCGGAACCCGCAACAGCGGCAAGCGAACCAAAAGAGGATGAGGACATCATTCGTCTGGTTGCAGAACGATAA |
| Sequence | MNDVLNSGAFSLASLIVSMVVLVVGLALWFFVNRASSRANEQIELLEALLDQQKRQNALLRRLCEANEPEKEAEPATAASEPKEDEDIIRLVAER |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of pfam13974. Profile Description: YebO-like protein. This short protein is uncharacterized. It seems likely to be of phage origin as it is found in Enterobacteria phage HK022 Gp20 and Enterobacteria phage HK97 Gp15. The protein is also found in a variety of enteric bacteria. |
| Pubmed ID | 11677609 |
| Domain | CDD:404798 |
| Functional Category | Others |
| Uniprot ID | P64501 |
| ORF Length (Amino Acid) | 95 |
++ More..
| Conservation Analysis |
No. of Species: 61
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1936558 | 1936845 | - | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
| 2 | 1984654 | 1984941 | - | NC_013716.1 | Citrobacter rodentium ICC168 |
| 3 | 4447574 | 4447861 | - | NZ_CP053416.1 | Salmonella bongori |
| 4 | 1799602 | 1799901 | + | NZ_CP054058.1 | Scandinavium goeteborgense |
| 5 | 1941588 | 1941875 | + | NZ_LR134340.1 | Escherichia marmotae |
| 6 | 4521176 | 4521460 | + | NZ_CP044098.1 | Citrobacter portucalensis |
| 7 | 691181 | 691471 | + | NZ_CP045769.1 | Enterobacter cancerogenus |
| 8 | 562094 | 562378 | - | NZ_CP033744.1 | Citrobacter freundii |
| 9 | 4153491 | 4153778 | - | NZ_LT556085.1 | Citrobacter amalonaticus |
| 10 | 1908261 | 1908548 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 11 | 2789012 | 2789299 | + | NZ_CP045205.1 | Citrobacter telavivensis |
| 12 | 2510227 | 2510514 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 13 | 1809960 | 1810247 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 14 | 1440972 | 1441259 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 15 | 1841173 | 1841460 | - | NZ_AP014857.1 | Escherichia albertii |
| 16 | 3539481 | 3539765 | + | NZ_CP042941.1 | Atlantibacter hermannii |
| 17 | 1546179 | 1546469 | - | NZ_CP023529.1 | Lelliottia amnigena |
| 18 | 2225706 | 2225996 | + | NZ_CP014007.2 | Kosakonia oryzae |
| 19 | 2798422 | 2798712 | - | NZ_CP027986.1 | Enterobacter sichuanensis |
| 20 | 1367046 | 1367327 | - | NZ_CP038469.1 | Citrobacter tructae |
| 21 | 2799471 | 2799761 | - | NZ_CP017184.1 | Enterobacter roggenkampii |
| 22 | 603930 | 604217 | - | NZ_AP019007.1 | Enterobacter oligotrophicus |
| 23 | 4491293 | 4491583 | + | NZ_CP025034.2 | Enterobacter sp. SGAir0187 |
| 24 | 123516 | 123806 | + | NZ_CP045300.1 | Kosakonia arachidis |
| 25 | 1116796 | 1117083 | + | NC_009792.1 | Citrobacter koseri ATCC BAA-895 |
| 26 | 1965258 | 1965548 | + | NZ_CP035129.1 | Kosakonia cowanii |
| 27 | 2852183 | 2852470 | - | NZ_CP063425.1 | Kosakonia pseudosacchari |
| 28 | 2019121 | 2019411 | - | NZ_CP017279.1 | Enterobacter ludwigii |
| 29 | 2776037 | 2776327 | - | NZ_AP022508.1 | Enterobacter bugandensis |
| 30 | 3336789 | 3337079 | - | NC_016845.1 | Klebsiella pneumoniae subsp. pneumoniae HS11286 |
| 31 | 1948369 | 1948659 | + | NZ_CP054254.1 | Klebsiella variicola |
| 32 | 262340 | 262627 | + | NZ_CP016337.1 | Kosakonia sacchari |
| 33 | 1900340 | 1900621 | + | NZ_CP023525.1 | Cedecea neteri |
| 34 | 237771 | 238058 | + | NZ_CP057657.1 | Escherichia fergusonii |
| 35 | 3768002 | 3768292 | - | NZ_CP051548.1 | Phytobacter diazotrophicus |
| 36 | 2539528 | 2539815 | - | NZ_CP011602.1 | Phytobacter ursingii |
| 37 | 1880347 | 1880637 | + | NZ_CP065838.1 | Klebsiella quasipneumoniae |
| 38 | 1822188 | 1822481 | + | NC_017910.1 | Shimwellia blattae DSM 4481 = NBRC 105725 |
| 39 | 1826149 | 1826427 | + | NZ_LR134201.1 | Cedecea lapagei |
| 40 | 4259438 | 4259710 | - | NZ_CP040428.1 | Jejubacter calystegiae |
| 41 | 1881217 | 1881507 | + | NZ_CP013990.1 | Leclercia adecarboxylata |
| 42 | 1892186 | 1892479 | + | NZ_CP045845.1 | Kluyvera intermedia |
| 43 | 2064872 | 2065156 | + | NZ_CP046672.1 | Raoultella ornithinolytica |
| 44 | 2981468 | 2981758 | - | NZ_CP015113.1 | Kosakonia radicincitans |
| 45 | 5212329 | 5212613 | - | NZ_CP026047.1 | Raoultella planticola |
| 46 | 1990364 | 1990648 | + | NZ_CP041247.1 | Raoultella electrica |
| 47 | 2343064 | 2343354 | + | NZ_CP036175.1 | Klebsiella huaxiensis |
| 48 | 2252126 | 2252416 | + | NZ_CP060111.1 | Klebsiella michiganensis |
| 49 | 4061918 | 4062211 | - | NZ_CP020388.1 | Pluralibacter gergoviae |
| 50 | 2887663 | 2887953 | - | NZ_CP009756.1 | Enterobacter cloacae |
| 51 | 2012014 | 2012304 | + | NZ_LR134475.1 | Klebsiella aerogenes |
| 52 | 894887 | 895174 | + | NZ_CP027107.1 | Cronobacter sakazakii |
| 53 | 1629787 | 1630074 | + | NZ_CP013940.1 | Cronobacter malonaticus LMG 23826 |
| 54 | 2555530 | 2555817 | - | NZ_CP012257.1 | Cronobacter universalis NCTC 9529 |
| 55 | 2105243 | 2105533 | + | NZ_CP050508.1 | Raoultella terrigena |
| 56 | 2596755 | 2597042 | - | NZ_CP012266.1 | Cronobacter dublinensis subsp. dublinensis LMG 23823 |
| 57 | 2729885 | 2730175 | - | NC_015968.1 | Enterobacter soli |
| 58 | 2678534 | 2678833 | - | NZ_CP012871.1 | [Enterobacter] lignolyticus |
| 59 | 1917065 | 1917352 | + | NZ_AP023184.1 | Buttiauxella agrestis |
| 60 | 1462948 | 1463229 | + | NZ_CP012268.1 | Cronobacter muytjensii ATCC 51329 |
| 61 | 2514609 | 2514896 | - | NZ_CP012264.1 | Cronobacter condimenti 1330 |
| 62 | 2112351 | 2112623 | + | NC_017554.1 | Pantoea ananatis PA13 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP045205.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF06173.14 | 0.72 | 44 | 4690 | opposite-strand | Protein of unknown function (DUF986) |
| 2 | PF02659.17 | 0.95 | 58 | 3793 | opposite-strand | Putative manganese efflux pump |
| 3 | PF13649.8 | 1.0 | 61 | 2985.5 | same-strand | Methyltransferase domain |
| 4 | PF08241.14 | 1.0 | 61 | 2985.5 | same-strand | Methyltransferase domain |
| 5 | PF00905.24 | 0.62 | 38 | 1243.0 | same-strand | Penicillin binding protein transpeptidase domain |
| 6 | PF03717.17 | 0.62 | 38 | 1243.0 | same-strand | Penicillin-binding Protein dimerisation domain |
| 7 | PF00313.24 | 0.98 | 60 | 920 | same-strand | 'Cold-shock' DNA-binding domain |
| 8 | PF13996.8 | 1.0 | 61 | 378.0 | opposite-strand | YobH-like protein |
| 9 | PF01614.20 | 1.0 | 61 | 680.0 | same-strand | Bacterial transcriptional regulator |
| 10 | PF09339.12 | 1.0 | 61 | 680.0 | same-strand | IclR helix-turn-helix domain |
| 11 | PF13412.8 | 1.0 | 61 | 680.0 | same-strand | Winged helix-turn-helix DNA-binding |
| 12 | PF07690.18 | 0.85 | 52 | 1654 | opposite-strand | Major Facilitator Superfamily |
| 13 | PF01435.20 | 0.97 | 59 | 3080.5 | same-strand | Peptidase family M48 |
| 14 | PF17804.3 | 0.66 | 40 | 4154 | same-strand | Tail specific protease N-terminal domain |
| 15 | PF03572.20 | 0.66 | 40 | 4154 | same-strand | Peptidase family S41 |
| 16 | PF11818.10 | 0.66 | 40 | 4154 | same-strand | C-terminal domain of tail specific protease (DUF3340) |
| 17 | PF00595.26 | 0.66 | 40 | 4154 | same-strand | PDZ domain |
| 18 | PF17820.3 | 0.66 | 40 | 4154 | same-strand | PDZ domain |
++ More..