Result : P64497
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Protein YoaG |
| NCBI Accession ID | AE014075.1 |
| Organism | Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) |
| Left | 2036637 |
| Right | 2036819 |
| Strand | - |
| Nucleotide Sequence | ATGGGCAAAGCAACGTATACCGTGACCGTCACCAATAACAGCAATGGCGTTTCTGTCGATTATGAAACAGAGACGCCGATGACTTTGCTGGTGCCAGAAGTGGCGGCTGAAGTGATAAAAGATCTGGTGAATACCGTGCGTTCTTATGACACGGAAAACGAACATGATGTTTGTGGTTGGTAA |
| Sequence | MGKATYTVTVTNNSNGVSVDYETETPMTLLVPEVAAEVIKDLVNTVRSYDTENEHDVCGW |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of pfam08956. Profile Description: Domain of unknown function (DUF1869). This domain is found in a set of hypothetical bacterial proteins. |
| Pubmed ID | 12471157 |
| Domain | CDD:401054 |
| Functional Category | Others |
| Uniprot ID | P64497 |
| ORF Length (Amino Acid) | 60 |
++ More..
| Conservation Analysis |
No. of Species: 34
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2054098 | 2054280 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 2 | 1965510 | 1965692 | + | NZ_LR134340.1 | Escherichia marmotae |
| 3 | 1879403 | 1879585 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 4 | 2481144 | 2481326 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 5 | 3756704 | 3756886 | + | NZ_CP053416.1 | Salmonella bongori |
| 6 | 1356680 | 1356862 | + | NC_013716.1 | Citrobacter rodentium ICC168 |
| 7 | 1351761 | 1351943 | + | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
| 8 | 1812046 | 1812228 | - | NZ_AP014857.1 | Escherichia albertii |
| 9 | 4127293 | 4127475 | - | NZ_LT556085.1 | Citrobacter amalonaticus |
| 10 | 2815369 | 2815551 | + | NZ_CP045205.1 | Citrobacter telavivensis |
| 11 | 1730509 | 1730691 | - | NC_009792.1 | Citrobacter koseri ATCC BAA-895 |
| 12 | 4737347 | 4737529 | + | NZ_CP033744.1 | Citrobacter freundii |
| 13 | 335739 | 335921 | - | NZ_CP044098.1 | Citrobacter portucalensis |
| 14 | 602062 | 602244 | + | NZ_CP038469.1 | Citrobacter tructae |
| 15 | 3083689 | 3083871 | + | NZ_CP023525.1 | Cedecea neteri |
| 16 | 2656578 | 2656760 | + | NZ_CP045845.1 | Kluyvera intermedia |
| 17 | 4072797 | 4072979 | - | NZ_CP042941.1 | Atlantibacter hermannii |
| 18 | 2864074 | 2864256 | + | NZ_LR134201.1 | Cedecea lapagei |
| 19 | 360849 | 361031 | + | NZ_AP019007.1 | Enterobacter oligotrophicus |
| 20 | 1273784 | 1273966 | + | NZ_CP023529.1 | Lelliottia amnigena |
| 21 | 2487287 | 2487469 | + | NC_015968.1 | Enterobacter soli |
| 22 | 985868 | 986050 | - | NZ_CP045769.1 | Enterobacter cancerogenus |
| 23 | 2462553 | 2462735 | + | NZ_AP022508.1 | Enterobacter bugandensis |
| 24 | 2306669 | 2306851 | - | NZ_CP013990.1 | Leclercia adecarboxylata |
| 25 | 3984909 | 3985091 | - | NZ_CP040428.1 | Jejubacter calystegiae |
| 26 | 1800575 | 1800730 | + | NZ_CP041247.1 | Raoultella electrica |
| 27 | 1802982 | 1803137 | + | NZ_CP046672.1 | Raoultella ornithinolytica |
| 28 | 5388390 | 5388545 | - | NZ_CP026047.1 | Raoultella planticola |
| 29 | 2121479 | 2121640 | + | NZ_CP036175.1 | Klebsiella huaxiensis |
| 30 | 1861994 | 1862149 | + | NZ_CP050508.1 | Raoultella terrigena |
| 31 | 669635 | 669826 | + | NZ_CP035129.1 | Kosakonia cowanii |
| 32 | 3223777 | 3223941 | + | NZ_CP051652.1 | Pectobacterium carotovorum |
| 33 | 1582257 | 1582412 | + | NZ_CP025799.1 | Dickeya zeae |
| 34 | 862065 | 862229 | - | NZ_CP015749.1 | Pectobacterium parmentieri |
| 35 | 2876595 | 2876756 | - | NC_017910.1 | Shimwellia blattae DSM 4481 = NBRC 105725 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP061527.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF09313.13 | 1.0 | 34 | 8.5 | same-strand | Domain of unknown function (DUF1971) |
++ More..