Result : P64494
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YoaF |
| NCBI Accession ID | AE014075.1 |
| Organism | Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) |
| Left | 2034511 |
| Right | 2034765 |
| Strand | - |
| Nucleotide Sequence | ATGAAAATTATCAGTTTTGTTCTGCCTTGCTTGCTGGTCCTGGCTGGTTGTTCAACCCCTTCTCAGCCAGAAGCACCTAAACCGCCGCAGATTGGTATGGCAAATCCGGCGTCGGTCTATTGCCAGCAGAAGGGCGGGACGCTCATTCCTGTGCAGACAGCGCAAGGGGTCAGCAACAATTGCAAATTACCGGGCGGTGAAACGATTGATGAATGGGCATTGTGGCGACGGGACCATCCGGCTGGTGAAAAATAA |
| Sequence | MKIISFVLPCLLVLAGCSTPSQPEAPKPPQIGMANPASVYCQQKGGTLIPVQTAQGVSNNCKLPGGETIDEWALWRRDHPAGEK |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl19829. Profile Description: Domain of unknown function (DUF333). This small domain of about 70 residues is found in a number of bacterial proteins. It is found at the N-terminus the of AF_1947 protein. The proteins containing this domain are uncharacterized. |
| Pubmed ID | 12471157 |
| Domain | CDD:418660 |
| Functional Category | Others |
| Uniprot ID | P64494 |
| ORF Length (Amino Acid) | 84 |
++ More..
| Conservation Analysis |
No. of Species: 47
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1469666 | 1469920 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 2 | 1877278 | 1877532 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 3 | 2056925 | 2057179 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 4 | 2479020 | 2479274 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 5 | 1967566 | 1967820 | + | NZ_LR134340.1 | Escherichia marmotae |
| 6 | 1810325 | 1810579 | - | NZ_AP014857.1 | Escherichia albertii |
| 7 | 4742684 | 4742932 | + | NZ_CP033744.1 | Citrobacter freundii |
| 8 | 330335 | 330583 | - | NZ_CP044098.1 | Citrobacter portucalensis |
| 9 | 607416 | 607664 | + | NZ_CP038469.1 | Citrobacter tructae |
| 10 | 1358765 | 1359019 | + | NC_013716.1 | Citrobacter rodentium ICC168 |
| 11 | 858522 | 858779 | - | NZ_CP057657.1 | Escherichia fergusonii |
| 12 | 1353810 | 1354061 | + | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
| 13 | 1085539 | 1085772 | - | NZ_CP016337.1 | Kosakonia sacchari |
| 14 | 2036422 | 2036655 | + | NZ_CP063425.1 | Kosakonia pseudosacchari |
| 15 | 1726040 | 1726294 | - | NC_009792.1 | Citrobacter koseri ATCC BAA-895 |
| 16 | 2708539 | 2708781 | - | NZ_CP054058.1 | Scandinavium goeteborgense |
| 17 | 2109197 | 2109445 | + | NZ_LR134475.1 | Klebsiella aerogenes |
| 18 | 3146366 | 3146608 | - | NZ_CP041247.1 | Raoultella electrica |
| 19 | 3758741 | 3758992 | + | NZ_CP053416.1 | Salmonella bongori |
| 20 | 3188825 | 3189067 | + | NZ_CP020388.1 | Pluralibacter gergoviae |
| 21 | 3323311 | 3323550 | - | NZ_CP054254.1 | Klebsiella variicola |
| 22 | 2651875 | 2652111 | - | NZ_CP045845.1 | Kluyvera intermedia |
| 23 | 3494491 | 3494730 | - | NZ_CP036175.1 | Klebsiella huaxiensis |
| 24 | 3191520 | 3191765 | - | NZ_CP014007.2 | Kosakonia oryzae |
| 25 | 1034800 | 1035045 | - | NZ_CP045300.1 | Kosakonia arachidis |
| 26 | 1992942 | 1993187 | + | NZ_CP015113.1 | Kosakonia radicincitans |
| 27 | 2707941 | 2708186 | - | NZ_CP035129.1 | Kosakonia cowanii |
| 28 | 3880755 | 3881006 | + | NZ_CP026047.1 | Raoultella planticola |
| 29 | 3365499 | 3365750 | - | NZ_CP046672.1 | Raoultella ornithinolytica |
| 30 | 3482115 | 3482366 | - | NZ_CP050508.1 | Raoultella terrigena |
| 31 | 3619412 | 3619651 | - | NZ_CP060111.1 | Klebsiella michiganensis |
| 32 | 1931308 | 1931547 | + | NZ_CP023525.1 | Cedecea neteri |
| 33 | 1334974 | 1335216 | + | NZ_CP011602.1 | Phytobacter ursingii |
| 34 | 370595 | 370807 | - | NZ_CP023706.1 | Edwardsiella tarda |
| 35 | 2599159 | 2599401 | + | NZ_CP051548.1 | Phytobacter diazotrophicus |
| 36 | 1950667 | 1950903 | + | NZ_AP023184.1 | Buttiauxella agrestis |
| 37 | 3047237 | 3047458 | + | NZ_CP019706.1 | Pantoea alhagi |
| 38 | 812457 | 812702 | + | NZ_CP029822.1 | Entomomonas moraniae |
| 39 | 1324690 | 1324935 | - | NZ_CP029822.1 | Entomomonas moraniae |
| 40 | 1973355 | 1973591 | + | NZ_CP012871.1 | [Enterobacter] lignolyticus |
| 41 | 1485084 | 1485305 | - | NZ_CP014136.1 | Gibbsiella quercinecans |
| 42 | 2030927 | 2031157 | - | NZ_CP028271.1 | Mixta intestinalis |
| 43 | 4453206 | 4453433 | + | NZ_AP019312.1 | Chromobacterium haemolyticum |
| 44 | 1415743 | 1415979 | + | NC_012779.2 | Edwardsiella ictaluri 93-146 |
| 45 | 2293356 | 2293589 | - | NZ_CP023536.1 | Providencia alcalifaciens |
| 46 | 999749 | 999967 | + | NZ_CP038662.1 | Serratia nematodiphila |
| 47 | 2726179 | 2726397 | - | NZ_CP050150.1 | Hafnia alvei |
| 48 | 955997 | 956260 | + | NZ_CP048784.1 | Serratia liquefaciens |
| 49 | 1026441 | 1026650 | + | NC_015567.1 | Serratia plymuthica AS9 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_004337.2
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00990.23 | 0.64 | 30 | 313.0 | opposite-strand | Diguanylate cyclase, GGDEF domain |
| 2 | PF04343.15 | 0.68 | 32 | 22 | opposite-strand | Protein of unknown function, DUF488 |
| 3 | PF07690.18 | 0.64 | 30 | 1694 | opposite-strand | Major Facilitator Superfamily |
++ More..