ProsmORF-pred
Result : P64477
Protein Information
Information Type Description
Protein name Uncharacterized protein YdiH
NCBI Accession ID
Organism Escherichia coli O157:H7
Left
Right
Strand
Nucleotide Sequence
Sequence MSTQLDPTQLAIEFLRRDQSNLSPAQYLKRLKQLELEFADLLTLSSAELKEEIYFAWRLGVH
Source of smORF Swiss-Prot
Function The ORF matches to the profile of pfam15930. Profile Description: Domain of unknown function. YdiH is a family of proteins found in bacteria. Proteins in this family are typically between 62 and 80 amino acids in length. The function is not known.
Pubmed ID 11206551 11258796
Domain CDD:318201
Functional Category Others
Uniprot ID P64477
ORF Length (Amino Acid) 62
++ More..
Conservation Analysis
Conservation Analysis
No. of Species: 52
Sr.No. Left Position Right Position Strand NCBI Accession id Species Name
1 1747849 1748037 - NC_004337.2 Shigella flexneri 2a str. 301
2 1764934 1765122 - NC_000913.3 Escherichia coli str. K-12 substr. MG1655
3 2364783 2364971 - NC_002695.2 Escherichia coli O157:H7 str. Sakai
4 2053974 2054162 + NZ_LR134340.1 Escherichia marmotae
5 2070545 2070733 + NZ_CP061527.1 Shigella dysenteriae
6 1699586 1699774 - NZ_AP014857.1 Escherichia albertii
7 1644900 1645088 - NC_009792.1 Citrobacter koseri ATCC BAA-895
8 3848129 3848317 + NZ_CP053416.1 Salmonella bongori
9 1466756 1466944 + NC_013716.1 Citrobacter rodentium ICC168
10 1450057 1450245 + NC_003197.2 Salmonella enterica subsp. enterica serovar Typhimurium str. LT2
11 206683 206871 - NZ_CP044098.1 Citrobacter portucalensis
12 4858142 4858330 + NZ_CP033744.1 Citrobacter freundii
13 3606846 3607034 + NZ_LT556085.1 Citrobacter amalonaticus
14 1916858 1917052 + NC_015968.1 Enterobacter soli
15 710965 711153 + NZ_CP038469.1 Citrobacter tructae
16 3391372 3391560 - NZ_CP045205.1 Citrobacter telavivensis
17 393460 393648 + NZ_CP057657.1 Escherichia fergusonii
18 4418505 4418699 + NZ_AP019007.1 Enterobacter oligotrophicus
19 1890664 1890858 + NZ_CP017184.1 Enterobacter roggenkampii
20 588979 589173 - NZ_CP025034.2 Enterobacter sp. SGAir0187
21 1166220 1166414 + NZ_CP017279.1 Enterobacter ludwigii
22 2171804 2171998 + NZ_CP043318.1 Enterobacter chengduensis
23 1961259 1961453 + NZ_CP027986.1 Enterobacter sichuanensis
24 1956386 1956580 + NZ_CP009756.1 Enterobacter cloacae
25 826899 827093 + NZ_CP023529.1 Lelliottia amnigena
26 1504865 1505059 - NZ_CP045769.1 Enterobacter cancerogenus
27 1928019 1928213 + NZ_AP022508.1 Enterobacter bugandensis
28 554999 555187 + NZ_CP016337.1 Kosakonia sacchari
29 3017821 3018009 + NZ_CP051548.1 Phytobacter diazotrophicus
30 1999987 2000175 - NZ_CP011602.1 Phytobacter ursingii
31 2564232 2564420 - NZ_CP063425.1 Kosakonia pseudosacchari
32 2548295 2548483 + NZ_CP014007.2 Kosakonia oryzae
33 502953 503141 + NZ_CP045300.1 Kosakonia arachidis
34 2640726 2640914 - NZ_CP015113.1 Kosakonia radicincitans
35 2093143 2093331 + NZ_CP054058.1 Scandinavium goeteborgense
36 2378841 2379029 - NZ_CP012871.1 [Enterobacter] lignolyticus
37 2265609 2265797 + NZ_CP035129.1 Kosakonia cowanii
38 2402128 2402316 - NZ_CP045845.1 Kluyvera intermedia
39 2536411 2536599 + NZ_CP046672.1 Raoultella ornithinolytica
40 4735242 4735430 - NZ_CP026047.1 Raoultella planticola
41 2392885 2393073 + NZ_CP041247.1 Raoultella electrica
42 2592659 2592847 + NZ_CP050508.1 Raoultella terrigena
43 3734403 3734591 - NZ_CP020388.1 Pluralibacter gergoviae
44 2547145 2547333 - NZ_CP023525.1 Cedecea neteri
45 1754529 1754717 + NC_017910.1 Shimwellia blattae DSM 4481 = NBRC 105725
46 2678139 2678327 + NZ_CP060111.1 Klebsiella michiganensis
47 2751945 2752133 + NZ_CP036175.1 Klebsiella huaxiensis
48 2726158 2726346 - NZ_CP065838.1 Klebsiella quasipneumoniae
49 2936828 2937016 - NZ_CP054254.1 Klebsiella variicola
50 2811621 2811809 - NZ_LR134475.1 Klebsiella aerogenes
51 2467492 2467680 + NC_016845.1 Klebsiella pneumoniae subsp. pneumoniae HS11286
52 2389764 2389952 - NZ_LR134201.1 Cedecea lapagei
53 4494388 4494576 - NZ_CP040428.1 Jejubacter calystegiae
++ More..