Result : A0L4Y6
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 30S ribosomal protein S16 |
| NCBI Accession ID | CP000471.1 |
| Organism | Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) |
| Left | 609096 |
| Right | 609347 |
| Strand | + |
| Nucleotide Sequence | ATGGCCGTTTGCATCCGTCTGGCACGTGGTGGTAAGAAAAAGAAACCCGTCTACAGTGTGGTTGTCGCTGACAAGCGCATGGCACGTGATGGTCGCTTTCTTGAGAAATTGGGGCAGTACATCCCCATGAAAGAGGGCGGTACATTCGCCATCAATCAAGAGCGTTATGCGCACTGGATCAGCCAAGGTGCCAAGCCTTCCGAAACGGTGGGTAAGTTGGTTGCCAAGCAACAGAACGCCGCTGAAGCCTAA |
| Sequence | MAVCIRLARGGKKKKPVYSVVVADKRMARDGRFLEKLGQYIPMKEGGTFAINQERYAHWISQGAKPSETVGKLVAKQQNAAEA |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl00368. Profile Description: Ribosomal protein S16. This model describes ribosomal S16 of bacteria and organelles. [Protein synthesis, Ribosomal proteins: synthesis and modification] |
| Pubmed ID | 19465526 |
| Domain | CDD:412339 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | A0L4Y6 |
| ORF Length (Amino Acid) | 83 |
++ More..
| Conservation Analysis |
No. of Species: 289
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 609096 | 609347 | + | NC_008576.1 | Magnetococcus marinus MC-1 |
| 2 | 383121 | 383363 | - | NZ_AP021898.1 | Akkermansia muciniphila |
| 3 | 1145135 | 1145392 | - | NC_008609.1 | Pelobacter propionicus DSM 2379 |
| 4 | 2826218 | 2826475 | - | NZ_AP021876.1 | Desulfosarcina ovata subsp. sediminis |
| 5 | 2595525 | 2595785 | - | NC_007498.2 | Syntrophotalea carbinolica DSM 2380 |
| 6 | 6750510 | 6750764 | + | NZ_AP021875.1 | Desulfosarcina widdelii |
| 7 | 1284293 | 1284541 | + | NZ_CP059565.1 | Neisseria wadsworthii |
| 8 | 73238 | 73486 | - | NZ_LR134313.1 | Neisseria canis |
| 9 | 1854272 | 1854514 | - | NZ_CP026328.2 | Acidithiobacillus caldus |
| 10 | 2274751 | 2275008 | + | NZ_CP012362.1 | Oblitimonas alkaliphila |
| 11 | 940847 | 941074 | + | NC_013960.1 | Nitrosococcus halophilus Nc 4 |
| 12 | 3092246 | 3092506 | + | NZ_CP015519.1 | Syntrophotalea acetylenivorans |
| 13 | 712004 | 712252 | + | NZ_AP018786.1 | Sutterella megalosphaeroides |
| 14 | 3702069 | 3702329 | + | NC_008554.1 | Syntrophobacter fumaroxidans MPOB |
| 15 | 3746821 | 3747081 | + | NC_008554.1 | Syntrophobacter fumaroxidans MPOB |
| 16 | 2539999 | 2540244 | - | NC_011761.1 | Acidithiobacillus ferrooxidans ATCC 23270 |
| 17 | 3753640 | 3753885 | + | NZ_CP048000.1 | Anaerocolumna sedimenticola |
| 18 | 2489241 | 2489486 | - | NC_007947.1 | Methylobacillus flagellatus KT |
| 19 | 3775617 | 3775853 | + | NZ_CP037953.1 | Permianibacter aggregans |
| 20 | 788268 | 788513 | - | NZ_AP018795.1 | Acidithiobacillus ferridurans |
| 21 | 2385421 | 2385672 | + | NZ_CP040105.1 | Acinetobacter nosocomialis M2 |
| 22 | 2822406 | 2822657 | - | NC_016603.1 | Acinetobacter pittii PHEA-2 |
| 23 | 2297746 | 2297997 | + | NZ_CP070518.1 | Acinetobacter calcoaceticus |
| 24 | 355533 | 355784 | + | NZ_CP053391.1 | Acinetobacter lactucae |
| 25 | 350456 | 350707 | + | NZ_CP015121.1 | Acinetobacter baumannii |
| 26 | 384007 | 384258 | + | NZ_CP065820.1 | Acinetobacter seifertii |
| 27 | 362673 | 362924 | + | NC_014259.1 | Acinetobacter oleivorans DR1 |
| 28 | 390874 | 391119 | + | NZ_CP011158.1 | Moraxella ovis |
| 29 | 3219822 | 3220091 | - | NZ_CP010802.1 | Desulfuromonas soudanensis |
| 30 | 1954699 | 1954971 | - | NZ_CP048104.1 | Kroppenstedtia pulmonis |
| 31 | 3088140 | 3088391 | - | NZ_CP054140.1 | Desulfobulbus oligotrophicus |
| 32 | 1208218 | 1208460 | + | NZ_LN879430.1 | Herbinix luporum |
| 33 | 1039945 | 1040217 | + | NZ_CP012152.1 | Anoxybacillus gonensis |
| 34 | 3658774 | 3659025 | + | NZ_CP036200.1 | Shewanella maritima |
| 35 | 1487224 | 1487469 | - | NZ_LR590481.1 | Hathewaya histolytica |
| 36 | 2606735 | 2606962 | - | NC_007484.1 | Nitrosococcus oceani ATCC 19707 |
| 37 | 2288677 | 2288904 | - | NC_014315.1 | Nitrosococcus watsonii C-113 |
| 38 | 305370 | 305615 | + | NC_015942.1 | Acidithiobacillus ferrivorans SS3 |
| 39 | 3061194 | 3061439 | - | NZ_CP045571.1 | Acidithiobacillus thiooxidans ATCC 19377 |
| 40 | 830593 | 830841 | + | NZ_CP019448.1 | Simonsiella muelleri ATCC 29453 |
| 41 | 2789376 | 2789648 | - | NZ_CP070511.1 | Parageobacillus toebii |
| 42 | 3894146 | 3894373 | - | NZ_CP038033.1 | Nitrosococcus wardiae |
| 43 | 1041375 | 1041647 | - | NZ_LS483403.1 | Streptococcus lutetiensis |
| 44 | 1133711 | 1133959 | - | NZ_CP025682.1 | Azoarcus pumilus |
| 45 | 617968 | 618240 | + | NZ_CP064060.1 | Anoxybacillus caldiproteolyticus |
| 46 | 3007581 | 3007838 | - | NZ_CP049916.1 | Acinetobacter lanii |
| 47 | 3151156 | 3151413 | - | NZ_CP049801.1 | Acinetobacter shaoyimingii |
| 48 | 44364 | 44612 | - | NZ_LR134343.1 | Moraxella cuniculi |
| 49 | 2308165 | 2308398 | + | NZ_CP031252.1 | Neisseria elongata |
| 50 | 3239323 | 3239568 | - | NZ_AP023367.1 | Anaerocolumna cellulosilytica |
| 51 | 2763568 | 2763840 | - | NZ_CP018058.1 | Geobacillus thermocatenulatus |
| 52 | 1185871 | 1186128 | + | NZ_CP020953.1 | Clostridium drakei |
| 53 | 147144 | 147401 | + | NZ_CP011803.1 | Clostridium carboxidivorans P7 |
| 54 | 1219069 | 1219341 | + | NC_006510.1 | Geobacillus kaustophilus HTA426 |
| 55 | 304927 | 305199 | + | NZ_CP061470.1 | Geobacillus zalihae |
| 56 | 666921 | 667193 | + | NZ_CP061472.1 | Geobacillus thermoleovorans |
| 57 | 1431549 | 1431821 | + | NZ_CP015438.1 | Anoxybacillus amylolyticus |
| 58 | 2151016 | 2151288 | - | NZ_CP014342.1 | Geobacillus subterraneus |
| 59 | 314299 | 314556 | + | NZ_CP030880.1 | Acinetobacter haemolyticus |
| 60 | 3593775 | 3594047 | - | NZ_CP053073.1 | Usitatibacter palustris |
| 61 | 403355 | 403603 | + | NC_014147.1 | Moraxella catarrhalis BBH18 |
| 62 | 1385412 | 1385672 | - | NC_014216.1 | Desulfurivibrio alkaliphilus AHT 2 |
| 63 | 3965867 | 3966118 | + | NZ_CP045302.1 | Azotobacter salinestris |
| 64 | 874601 | 874849 | + | NZ_CP009610.1 | Haemophilus influenzae |
| 65 | 963832 | 964080 | + | NZ_LS483429.1 | Haemophilus aegyptius |
| 66 | 1104132 | 1104380 | - | NZ_LR134327.1 | Aggregatibacter aphrophilus ATCC 33389 |
| 67 | 3218930 | 3219187 | - | NC_005966.1 | Acinetobacter baylyi ADP1 |
| 68 | 987805 | 988050 | + | NZ_LT635772.1 | Anaerococcus mediterraneensis |
| 69 | 345229 | 345474 | + | NZ_CP011381.2 | Moraxella bovoculi |
| 70 | 695744 | 695992 | + | NZ_CP016043.1 | Edwardsiella hoshinae |
| 71 | 3082079 | 3082336 | - | NZ_CP009933.1 | Clostridium scatologenes |
| 72 | 148578 | 148826 | - | NZ_LS483443.1 | Aggregatibacter segnis ATCC 33393 |
| 73 | 5024631 | 5024882 | - | NZ_AP014862.1 | Pseudomonas furukawaii |
| 74 | 2527247 | 2527495 | - | NZ_CP028842.1 | Clostridium botulinum |
| 75 | 954362 | 954610 | + | NZ_CP072844.1 | Psychrosphaera aestuarii |
| 76 | 2375339 | 2375593 | - | NZ_AP021881.1 | Sulfuriferula nivalis |
| 77 | 4134593 | 4134871 | - | NZ_CP053069.1 | Usitatibacter rugosus |
| 78 | 1180748 | 1181017 | + | NZ_CP035130.1 | Gudongella oleilytica |
| 79 | 2432865 | 2433122 | - | NZ_CP045650.1 | Acinetobacter wanghuae |
| 80 | 3397907 | 3398179 | - | NZ_CP017703.1 | Aeribacillus pallidus |
| 81 | 4004263 | 4004514 | - | NC_012560.1 | Azotobacter vinelandii DJ |
| 82 | 4880918 | 4881169 | - | NZ_AP022642.1 | Pseudomonas otitidis |
| 83 | 2104587 | 2104835 | + | NZ_CP048833.1 | Pseudomonas multiresinivorans |
| 84 | 1790523 | 1790747 | - | NZ_CP024955.1 | Kyrpidia spormannii |
| 85 | 325532 | 325789 | + | NZ_CP016895.1 | Acinetobacter larvae |
| 86 | 339911 | 340168 | + | NZ_CP044483.1 | Acinetobacter schindleri |
| 87 | 1438065 | 1438325 | + | NZ_CP022121.1 | Dehalobacterium formicoaceticum |
| 88 | 2211647 | 2211892 | - | NZ_CP013019.1 | Clostridium pasteurianum |
| 89 | 1951167 | 1951439 | + | NZ_CP045875.1 | Heliorestis convoluta |
| 90 | 4845779 | 4846030 | - | NZ_CP043311.1 | Pseudomonas lalkuanensis |
| 91 | 377879 | 378136 | + | NZ_AP014630.1 | Acinetobacter guillouiae |
| 92 | 257527 | 257775 | + | NZ_CP020465.1 | Cognaticolwellia beringensis |
| 93 | 1305721 | 1305993 | - | NZ_LR134512.1 | Streptococcus agalactiae |
| 94 | 367499 | 367756 | + | NZ_CP024632.1 | Acinetobacter junii |
| 95 | 1467323 | 1467598 | + | NC_014098.1 | Kyrpidia tusciae DSM 2912 |
| 96 | 515702 | 515947 | + | NZ_CP065728.1 | Moraxella nonliquefaciens |
| 97 | 4130752 | 4131012 | + | NC_008095.1 | Myxococcus xanthus DK 1622 |
| 98 | 1659203 | 1659475 | + | NZ_CP015378.1 | Fictibacillus phosphorivorans |
| 99 | 1712949 | 1713206 | - | NZ_CP021376.1 | Oceanisphaera avium |
| 100 | 2009161 | 2009406 | + | NC_016627.1 | Acetivibrio clariflavus DSM 19732 |
| 101 | 774850 | 775092 | - | NZ_HF545616.1 | Ruminococcus bicirculans |
| 102 | 1708224 | 1708496 | + | NZ_AP017312.1 | Aneurinibacillus soli |
| 103 | 73251 | 73496 | - | NZ_CP067016.1 | Anaerococcus obesiensis |
| 104 | 938183 | 938455 | - | NZ_CP035485.1 | Salicibibacter halophilus |
| 105 | 1351561 | 1351806 | - | NZ_CP066014.1 | Anaerococcus vaginalis |
| 106 | 1754235 | 1754483 | + | NZ_LR134516.1 | Neisseria animaloris |
| 107 | 1603814 | 1604065 | + | NZ_CP060009.1 | Pseudomonas sediminis |
| 108 | 4011160 | 4011411 | - | NZ_CP068551.1 | Pseudomonas khazarica |
| 109 | 1669966 | 1670238 | + | NZ_CP023704.1 | Caldibacillus thermoamylovorans |
| 110 | 362146 | 362391 | + | NZ_CP030241.1 | Moraxella bovis |
| 111 | 3434178 | 3434450 | + | NZ_CP021434.1 | Tumebacillus avium |
| 112 | 2931751 | 2932023 | - | NZ_CP022657.1 | Tumebacillus algifaecis |
| 113 | 1442092 | 1442340 | + | NC_010718.1 | Natranaerobius thermophilus JW/NM-WN-LF |
| 114 | 3418970 | 3419221 | - | NZ_CP011835.1 | Azotobacter chroococcum |
| 115 | 822000 | 822245 | + | NC_011898.1 | Ruminiclostridium cellulolyticum H10 |
| 116 | 2928677 | 2928931 | - | NZ_CP021455.1 | Comamonas serinivorans |
| 117 | 2772502 | 2772753 | - | NZ_CP014782.1 | Shewanella psychrophila |
| 118 | 139482 | 139754 | + | NZ_CP009709.1 | Weizmannia coagulans DSM 1 = ATCC 7050 |
| 119 | 805640 | 805876 | + | NC_014541.1 | Ferrimonas balearica DSM 9799 |
| 120 | 1438006 | 1438257 | + | NZ_CP046378.1 | Shewanella algae |
| 121 | 4512392 | 4512643 | - | NZ_CP024159.1 | Pseudomonas mosselii |
| 122 | 4546494 | 4546745 | - | NC_008027.1 | Pseudomonas entomophila L48 |
| 123 | 3720155 | 3720406 | - | NZ_CP009365.1 | Pseudomonas soli |
| 124 | 4697593 | 4697844 | + | NZ_CP031146.1 | Pseudomonas plecoglossicida |
| 125 | 1501292 | 1501564 | + | NZ_CP040336.1 | Bacillus luti |
| 126 | 3658378 | 3658650 | - | NC_007530.2 | Bacillus anthracis str. 'Ames Ancestor' |
| 127 | 3727923 | 3728195 | - | NZ_CP064875.1 | Bacillus toyonensis |
| 128 | 3862973 | 3863245 | - | NC_011725.1 | Bacillus cereus B4264 |
| 129 | 3867215 | 3867487 | - | NZ_CP032365.1 | Bacillus wiedmannii |
| 130 | 2567570 | 2567842 | - | NZ_CP018866.1 | Sutcliffiella cohnii |
| 131 | 1278522 | 1278767 | + | NZ_CP027286.1 | Clostridium chauvoei |
| 132 | 1764093 | 1764365 | + | NC_022524.1 | Bacillus infantis NRRL B-14911 |
| 133 | 551878 | 552147 | + | NZ_CP016379.1 | Anoxybacter fermentans |
| 134 | 188016 | 188261 | - | NZ_CP023671.1 | Clostridium septicum |
| 135 | 2066703 | 2066975 | + | NZ_CP042593.1 | Bacillus dafuensis |
| 136 | 2789733 | 2789981 | - | NZ_CP011663.1 | Clostridium sporogenes |
| 137 | 3251293 | 3251541 | - | NC_012691.1 | Tolumonas auensis DSM 9187 |
| 138 | 130958 | 131194 | + | NZ_CP051180.1 | Ferrimonas lipolytica |
| 139 | 3932203 | 3932457 | + | NC_018645.1 | Desulfobacula toluolica Tol2 |
| 140 | 2184487 | 2184759 | + | NC_010337.2 | Heliomicrobium modesticaldum Ice1 |
| 141 | 2573814 | 2574086 | - | NZ_CP065425.1 | Heyndrickxia vini |
| 142 | 24960 | 25202 | - | NZ_CP059564.1 | Alysiella filiformis |
| 143 | 4965660 | 4965932 | - | NZ_CP041305.1 | Cytobacillus ciccensis |
| 144 | 2332666 | 2332917 | + | NZ_CP021377.1 | Oceanisphaera profunda |
| 145 | 851024 | 851266 | + | NZ_CP030777.1 | Faecalibacterium prausnitzii |
| 146 | 1988019 | 1988291 | - | NZ_CP012502.1 | Bacillus beveridgei |
| 147 | 1253347 | 1253604 | - | NZ_CP037899.1 | Methylacidiphilum kamchatkense Kam1 |
| 148 | 633499 | 633753 | - | NZ_AP021884.1 | Sulfuriferula plumbiphila |
| 149 | 1178353 | 1178583 | + | NZ_CP043042.1 | Marinobacter fonticola |
| 150 | 1802527 | 1802799 | + | NZ_CP016622.1 | Parageobacillus thermoglucosidasius |
| 151 | 2377977 | 2378228 | - | NC_007759.1 | Syntrophus aciditrophicus SB |
| 152 | 1607271 | 1607522 | - | NZ_CP036523.1 | Peptacetobacter hiranonis |
| 153 | 2526675 | 2526917 | - | NC_015275.1 | Cellulosilyticum lentocellum DSM 5427 |
| 154 | 2905812 | 2906054 | - | NZ_CP015756.1 | Clostridium estertheticum subsp. estertheticum |
| 155 | 1284453 | 1284698 | + | NZ_CP064338.1 | Schlegelella thermodepolymerans |
| 156 | 1713057 | 1713302 | + | NZ_CP016502.1 | Acetivibrio thermocellus DSM 2360 |
| 157 | 4196708 | 4196959 | - | NC_002516.2 | Pseudomonas aeruginosa PAO1 |
| 158 | 1242180 | 1242431 | + | NZ_CP022562.1 | Pseudomonas monteilii |
| 159 | 892458 | 892706 | + | NC_008260.1 | Alcanivorax borkumensis SK2 |
| 160 | 4277996 | 4278241 | - | NC_003910.7 | Colwellia psychrerythraea 34H |
| 161 | 229706 | 229969 | - | NZ_CP040111.1 | Ehrlichia ruminantium |
| 162 | 2332271 | 2332543 | - | NZ_CP011937.1 | Bacillus velezensis |
| 163 | 1628603 | 1628875 | + | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 164 | 2586248 | 2586520 | - | NZ_CP024109.1 | Bacillus cytotoxicus |
| 165 | 1262692 | 1262964 | - | NZ_CP068053.1 | Peribacillus psychrosaccharolyticus |
| 166 | 3416245 | 3416496 | - | NZ_AP022853.1 | Sulfurimicrobium lacus |
| 167 | 456312 | 456515 | - | NC_008344.1 | Nitrosomonas eutropha C91 |
| 168 | 2600807 | 2601079 | - | NC_002570.2 | Alkalihalobacillus halodurans C-125 |
| 169 | 2671239 | 2671511 | - | NZ_LS483476.1 | Lederbergia lentus |
| 170 | 124028 | 124300 | - | NZ_CP017786.1 | Bacillus xiamenensis |
| 171 | 1575167 | 1575439 | + | NZ_CP011150.1 | Bacillus altitudinis |
| 172 | 3743746 | 3744018 | - | NZ_CP043404.1 | Bacillus safensis |
| 173 | 904675 | 904908 | + | NZ_CP013816.1 | Piscirickettsia salmonis |
| 174 | 3769127 | 3769381 | - | NZ_CP037867.1 | Hydrogenophaga pseudoflava |
| 175 | 3149027 | 3149278 | + | NZ_CP029822.1 | Entomomonas moraniae |
| 176 | 1945422 | 1945667 | + | NZ_CP021850.1 | Pseudoclostridium thermosuccinogenes |
| 177 | 149719 | 149991 | - | NZ_CP022983.1 | Cytobacillus kochii |
| 178 | 2673388 | 2673633 | - | NC_014624.2 | Eubacterium callanderi |
| 179 | 3103001 | 3103246 | + | NZ_CP019962.1 | Eubacterium limosum |
| 180 | 1604715 | 1604990 | - | NZ_CP040676.1 | Exiguobacterium mexicanum |
| 181 | 1305157 | 1305426 | - | NZ_CP012678.1 | Psychrobacter urativorans |
| 182 | 1069259 | 1069483 | + | NZ_CP011494.1 | Marinobacter psychrophilus |
| 183 | 1905146 | 1905367 | + | NC_015687.1 | Clostridium acetobutylicum DSM 1731 |
| 184 | 1367317 | 1367565 | + | NZ_CP051298.1 | Alicycliphilus denitrificans |
| 185 | 4233689 | 4233970 | - | NZ_AP018449.1 | Methylomusa anaerophila |
| 186 | 3391499 | 3391759 | - | NZ_CP016757.1 | Cloacibacillus porcorum |
| 187 | 428025 | 428297 | + | NZ_CP014699.1 | Streptococcus pantholopis |
| 188 | 5414094 | 5414342 | - | NZ_CP030840.1 | Acidisarcina polymorpha |
| 189 | 1229503 | 1229715 | - | NZ_AP019755.1 | Nitrosomonas stercoris |
| 190 | 1377921 | 1378169 | - | NZ_CP021255.1 | Desulfobulbus oralis |
| 191 | 2172082 | 2172315 | - | NZ_CP059571.1 | Neisseria bacilliformis |
| 192 | 4142274 | 4142528 | - | NZ_CP013236.1 | Collimonas pratensis |
| 193 | 3625420 | 3625668 | + | NZ_CP034759.1 | Litorilituus sediminis |
| 194 | 3118687 | 3118956 | - | NZ_CP014945.1 | Psychrobacter alimentarius |
| 195 | 2316616 | 2316819 | - | NZ_CP019070.1 | Poseidonibacter parvus |
| 196 | 3420292 | 3420552 | + | NC_013440.1 | Haliangium ochraceum DSM 14365 |
| 197 | 1760143 | 1760412 | - | NC_014378.1 | Acetohalobium arabaticum DSM 5501 |
| 198 | 452218 | 452484 | + | NZ_CP013341.1 | Nitrosomonas ureae |
| 199 | 1459617 | 1459889 | - | NZ_CP031733.1 | Streptococcus chenjunshii |
| 200 | 939401 | 939634 | + | NZ_CP011039.1 | Pseudoalteromonas spongiae UST010723-006 |
| 201 | 1162676 | 1162933 | - | NZ_CP045798.1 | Thermoanaerosceptrum fracticalcis |
| 202 | 4299739 | 4299984 | + | NZ_CP029487.1 | Eubacterium maltosivorans |
| 203 | 1688663 | 1688908 | - | NZ_CP014204.2 | Clostridium baratii |
| 204 | 5465945 | 5466193 | - | NZ_CP014158.1 | Pseudomonas citronellolis |
| 205 | 1592985 | 1593236 | + | NC_010506.1 | Shewanella woodyi ATCC 51908 |
| 206 | 747028 | 747300 | + | NZ_CP027563.1 | Weissella confusa |
| 207 | 418482 | 418721 | + | NZ_AP014545.1 | Amphritea japonica ATCC BAA-1530 |
| 208 | 1796924 | 1797178 | - | NZ_CP041783.1 | Shewanella donghaensis |
| 209 | 1040747 | 1041019 | - | NZ_CP017326.1 | Weissella soli |
| 210 | 845576 | 845800 | + | NZ_AP018724.1 | Sulfurivermis fontis |
| 211 | 1031584 | 1031832 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 212 | 4029248 | 4029496 | + | NZ_CP057657.1 | Escherichia fergusonii |
| 213 | 2744588 | 2744836 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 214 | 2745937 | 2746185 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 215 | 2715038 | 2715286 | - | NZ_AP014857.1 | Escherichia albertii |
| 216 | 3365572 | 3365823 | - | NZ_CP013235.1 | Collimonas arenae |
| 217 | 3466190 | 3466438 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 218 | 1616085 | 1616300 | - | NZ_AP022873.1 | Dissulfurispira thermophila |
| 219 | 2520499 | 2520747 | - | NC_012969.1 | Methylovorus glucosetrophus SIP3-4 |
| 220 | 1589251 | 1589502 | + | NZ_CP013232.1 | Collimonas fungivorans |
| 221 | 656839 | 657048 | + | NC_007614.1 | Nitrosospira multiformis ATCC 25196 |
| 222 | 1090720 | 1090965 | + | NC_015520.1 | Mahella australiensis 50-1 BON |
| 223 | 3405778 | 3406011 | - | NZ_CP042220.2 | Dickeya poaceiphila |
| 224 | 2371951 | 2372223 | - | NZ_CP016020.1 | Bacillus weihaiensis |
| 225 | 1658511 | 1658744 | + | NZ_CP009888.1 | Pseudoalteromonas piratica |
| 226 | 1567199 | 1567450 | - | NC_013124.1 | Acidimicrobium ferrooxidans DSM 10331 |
| 227 | 1120899 | 1121150 | + | NC_014012.1 | Shewanella violacea DSS12 |
| 228 | 1621426 | 1621629 | - | NZ_CP032099.1 | Aliarcobacter skirrowii CCUG 10374 |
| 229 | 3982972 | 3983223 | - | NC_011566.1 | Shewanella piezotolerans WP3 |
| 230 | 2880405 | 2880638 | - | NZ_CP013187.1 | Pseudoalteromonas phenolica |
| 231 | 9200210 | 9200476 | + | NZ_CP012333.1 | Labilithrix luteola |
| 232 | 1857095 | 1857370 | - | NC_010556.1 | Exiguobacterium sibiricum 255-15 |
| 233 | 2399530 | 2399763 | - | NZ_CP032090.1 | Pseudoalteromonas donghaensis |
| 234 | 1284706 | 1284957 | + | NZ_CP037951.1 | Parashewanella tropica |
| 235 | 2093172 | 2093420 | + | NZ_CP018139.1 | Halomonas aestuarii |
| 236 | 967972 | 968223 | + | NZ_CP060714.1 | Diaphorobacter ruginosibacter |
| 237 | 2769108 | 2769362 | - | NC_013959.1 | Sideroxydans lithotrophicus ES-1 |
| 238 | 1051331 | 1051582 | - | NZ_CP009238.1 | Basilea psittacipulmonis DSM 24701 |
| 239 | 1844244 | 1844501 | + | NZ_CP040924.1 | Clostridium thermarum |
| 240 | 2765777 | 2766010 | - | NZ_CP011025.1 | Pseudoalteromonas arctica A 37-1-2 |
| 241 | 3507985 | 3508218 | - | NZ_CP025799.1 | Dickeya zeae |
| 242 | 2615728 | 2615961 | - | NZ_CP027523.1 | Pseudoalteromonas carrageenovora |
| 243 | 1091790 | 1092023 | + | NZ_CP033065.1 | Pseudoalteromonas agarivorans |
| 244 | 2564498 | 2564731 | - | NZ_CP023464.1 | Pseudoalteromonas atlantica |
| 245 | 1134355 | 1134567 | + | NZ_CP021106.3 | Nitrosospira lacus |
| 246 | 3889530 | 3889763 | + | NZ_CP009787.1 | Yersinia rohdei |
| 247 | 974020 | 974253 | + | NC_007481.1 | Pseudoalteromonas translucida |
| 248 | 1038207 | 1038440 | + | NZ_CP011036.1 | Pseudoalteromonas nigrifaciens |
| 249 | 4462092 | 4462325 | - | NZ_CP019628.1 | Pseudoalteromonas aliena |
| 250 | 1439362 | 1439595 | + | NC_015318.1 | Hippea maritima DSM 10411 |
| 251 | 1380135 | 1380386 | + | NC_009831.1 | Shewanella sediminis HAW-EB3 |
| 252 | 2108523 | 2108777 | + | NZ_CP003915.1 | Advenella mimigardefordensis DPN7 |
| 253 | 1837364 | 1837600 | - | NZ_CP041730.1 | Chitinimonas arctica |
| 254 | 1176493 | 1176726 | + | NZ_CP011028.1 | Pseudoalteromonas espejiana DSM 9414 |
| 255 | 3401298 | 3401570 | + | NZ_CP063356.1 | Anaerobacillus isosaccharinicus |
| 256 | 1100704 | 1100937 | + | NZ_CP011041.1 | Pseudoalteromonas tetraodonis |
| 257 | 1086915 | 1087148 | + | NZ_CP011030.1 | Pseudoalteromonas issachenkonii |
| 258 | 686953 | 687186 | - | NZ_CP072133.1 | Pseudoalteromonas xiamenensis |
| 259 | 4042830 | 4043063 | - | NZ_CP072425.1 | Pseudoalteromonas viridis |
| 260 | 2723118 | 2723390 | - | NC_014829.1 | Evansella cellulosilytica DSM 2522 |
| 261 | 580285 | 580530 | + | NC_013895.2 | Mageeibacillus indolicus UPII9-5 |
| 262 | 3533821 | 3534036 | + | NZ_CP011451.1 | Nitrosomonas communis |
| 263 | 3544819 | 3545088 | - | NZ_CP041352.1 | Casimicrobium huifangae |
| 264 | 965755 | 966000 | + | NZ_CP017689.1 | Thalassotalea crassostreae |
| 265 | 4392741 | 4392989 | + | NZ_CP067057.1 | Rahnella aceris |
| 266 | 1479389 | 1479634 | - | NC_022549.1 | Acholeplasma brassicae |
| 267 | 1210935 | 1211192 | + | NZ_CP027792.1 | Pulveribacter suum |
| 268 | 1183008 | 1183262 | + | NC_008825.1 | Methylibium petroleiphilum PM1 |
| 269 | 543484 | 543735 | + | NZ_CP012621.1 | Zobellella denitrificans |
| 270 | 1767477 | 1767716 | - | NZ_CP054142.1 | Treponema parvum |
| 271 | 993439 | 993693 | + | NZ_AP022345.1 | Fluviibacter phosphoraccumulans |
| 272 | 1530620 | 1530871 | + | NZ_CP059560.1 | Aromatoleum petrolei |
| 273 | 5099258 | 5099506 | - | NZ_CP040428.1 | Jejubacter calystegiae |
| 274 | 4326246 | 4326497 | + | NC_008786.1 | Verminephrobacter eiseniae EF01-2 |
| 275 | 3890672 | 3890920 | - | NZ_CP061941.1 | Marinomonas algicola |
| 276 | 2631787 | 2632041 | - | NZ_LR778301.1 | Denitratisoma oestradiolicum |
| 277 | 1309550 | 1309765 | - | NC_021291.1 | Spiribacter salinus M19-40 |
| 278 | 1290788 | 1291036 | - | NZ_CP029331.1 | Thauera hydrothermalis |
| 279 | 2792057 | 2792311 | - | NZ_AP012547.1 | Sulfuritalea hydrogenivorans sk43H |
| 280 | 4226310 | 4226561 | + | NC_006513.1 | Aromatoleum aromaticum EbN1 |
| 281 | 2207391 | 2207594 | - | NZ_CP032098.1 | Malaciobacter molluscorum LMG 25693 |
| 282 | 6263072 | 6263338 | - | NC_010162.1 | Sorangium cellulosum So ce56 |
| 283 | 3512928 | 3513179 | - | NZ_CP059467.1 | Aromatoleum bremense |
| 284 | 2265756 | 2265959 | - | NZ_CP031219.1 | Malaciobacter mytili LMG 24559 |
| 285 | 866996 | 867244 | + | NZ_CP022579.1 | Oryzomicrobium terrae |
| 286 | 2018827 | 2019075 | - | NZ_AP018725.1 | Sulfuriflexus mobilis |
| 287 | 2204819 | 2205064 | - | NC_008261.1 | Clostridium perfringens ATCC 13124 |
| 288 | 547718 | 547951 | + | NZ_CP033078.1 | Vibrio zhugei |
| 289 | 1422417 | 1422665 | - | NZ_CP022987.1 | Pusillimonas thiosulfatoxidans |
| 290 | 413213 | 413470 | + | NZ_CP053986.1 | Achromobacter denitrificans |
| 291 | 705720 | 705968 | + | NZ_CP050851.1 | Aeromonas hydrophila |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_008576.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00448.24 | 0.69 | 199 | 174 | same-strand | SRP54-type protein, GTPase domain |
| 2 | PF02978.21 | 0.69 | 199 | 110 | same-strand | Signal peptide binding domain |
| 3 | PF02881.21 | 0.69 | 199 | 174 | same-strand | SRP54-type protein, helical bundle domain |
| 4 | PF01782.20 | 0.98 | 283 | 51 | same-strand | RimM N-terminal domain |
| 5 | PF05239.18 | 0.89 | 258 | 41.5 | same-strand | PRC-barrel domain |
| 6 | PF01746.23 | 0.96 | 277 | 619 | same-strand | tRNA (Guanine-1)-methyltransferase |
| 7 | PF01245.22 | 0.89 | 257 | 1480 | same-strand | Ribosomal protein L19 |
++ More..