Result : P64459
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YncJ |
| NCBI Accession ID | U00096.3 |
| Organism | Escherichia coli (strain K12) |
| Left | 1508834 |
| Right | 1509064 |
| Strand | - |
| Nucleotide Sequence | ATGTTTACGAAGGCGTTATCGGTTGTCTTATTAACGTGTGCTCTGTTTTCAGGACAACTCATGGCAGGGCACAAAGGACATGAATTTGTGTGGGTAAAGAATGTGGATCATCAGCTGCGTCATGAAGCGGACAGCGATGAATTGCGTGCTGTGGCGGAAGAGTCGGCGGAAGGTTTGCGCGAGCATTTTTACTGGCAAAAATCGCGCAAACCAGAAGCGGGACAACGTTGA |
| Sequence | MFTKALSVVLLTCALFSGQLMAGHKGHEFVWVKNVDHQLRHEADSDELRAVAEESAEGLREHFYWQKSRKPEAGQR |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of pfam10829. Profile Description: Protein of unknown function (DUF2554). This family of proteins with unknown function appears to be restricted to Enterobacteriaceae. |
| Pubmed ID | 9278503 16738553 |
| Domain | CDD:313921 |
| Functional Category | Others |
| Uniprot ID | P64459 |
| ORF Length (Amino Acid) | 76 |
++ More..
| Conservation Analysis |
No. of Species: 36
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1508834 | 1509064 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 2 | 2024734 | 2024964 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 3 | 2257598 | 2257828 | + | NZ_LR134340.1 | Escherichia marmotae |
| 4 | 2290741 | 2290971 | - | NZ_CP013990.1 | Leclercia adecarboxylata |
| 5 | 1493158 | 1493388 | - | NZ_AP014857.1 | Escherichia albertii |
| 6 | 538966 | 539196 | - | NZ_CP057657.1 | Escherichia fergusonii |
| 7 | 2300458 | 2300688 | - | NC_015968.1 | Enterobacter soli |
| 8 | 1089136 | 1089366 | - | NZ_CP023529.1 | Lelliottia amnigena |
| 9 | 2264924 | 2265154 | - | NZ_AP022508.1 | Enterobacter bugandensis |
| 10 | 2308445 | 2308675 | - | NZ_CP009756.1 | Enterobacter cloacae |
| 11 | 1193192 | 1193422 | + | NZ_CP045769.1 | Enterobacter cancerogenus |
| 12 | 1485880 | 1486110 | - | NZ_CP017279.1 | Enterobacter ludwigii |
| 13 | 2238182 | 2238412 | - | NZ_CP017184.1 | Enterobacter roggenkampii |
| 14 | 263074 | 263304 | + | NZ_CP025034.2 | Enterobacter sp. SGAir0187 |
| 15 | 228333 | 228563 | - | NZ_AP019007.1 | Enterobacter oligotrophicus |
| 16 | 2509726 | 2509956 | - | NZ_CP043318.1 | Enterobacter chengduensis |
| 17 | 2268816 | 2269016 | - | NZ_CP027986.1 | Enterobacter sichuanensis |
| 18 | 4097899 | 4098129 | + | NZ_CP053416.1 | Salmonella bongori |
| 19 | 1693399 | 1693629 | + | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
| 20 | 1702366 | 1702596 | + | NC_013716.1 | Citrobacter rodentium ICC168 |
| 21 | 4807132 | 4807362 | - | NZ_CP044098.1 | Citrobacter portucalensis |
| 22 | 202409 | 202639 | + | NZ_CP033744.1 | Citrobacter freundii |
| 23 | 1016259 | 1016489 | + | NZ_CP038469.1 | Citrobacter tructae |
| 24 | 1599504 | 1599734 | - | NZ_CP012871.1 | [Enterobacter] lignolyticus |
| 25 | 3024162 | 3024392 | + | NZ_CP054058.1 | Scandinavium goeteborgense |
| 26 | 2776180 | 2776410 | - | NZ_CP020388.1 | Pluralibacter gergoviae |
| 27 | 3216787 | 3217020 | + | NZ_CP060111.1 | Klebsiella michiganensis |
| 28 | 2909032 | 2909262 | + | NC_016845.1 | Klebsiella pneumoniae subsp. pneumoniae HS11286 |
| 29 | 3997787 | 3998017 | + | NZ_CP042941.1 | Atlantibacter hermannii |
| 30 | 3158337 | 3158570 | + | NZ_CP036175.1 | Klebsiella huaxiensis |
| 31 | 2330579 | 2330812 | - | NZ_CP065838.1 | Klebsiella quasipneumoniae |
| 32 | 2414102 | 2414335 | - | NZ_CP054254.1 | Klebsiella variicola |
| 33 | 4286370 | 4286603 | - | NZ_CP026047.1 | Raoultella planticola |
| 34 | 2991090 | 2991323 | + | NZ_CP046672.1 | Raoultella ornithinolytica |
| 35 | 2196708 | 2196947 | - | NZ_LR134201.1 | Cedecea lapagei |
| 36 | 2467804 | 2468001 | + | NZ_CP023525.1 | Cedecea neteri |
| 37 | 2236356 | 2236565 | - | NZ_AP023184.1 | Buttiauxella agrestis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP013990.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF03594.15 | 0.78 | 28 | 2673 | same-strand | Benzoate membrane transport protein |
| 2 | PF01381.24 | 0.83 | 30 | 2046.0 | opposite-strand | Helix-turn-helix |
| 3 | PF13560.8 | 0.81 | 29 | 2046.0 | opposite-strand | Helix-turn-helix domain |
| 4 | PF07883.13 | 0.86 | 31 | 2046.0 | opposite-strand | Cupin domain |
| 5 | PF12844.9 | 0.69 | 25 | 2046.0 | opposite-strand | Helix-turn-helix domain |
| 6 | PF01136.21 | 0.83 | 30 | 4 | opposite-strand | Peptidase family U32 |
| 7 | PF12392.10 | 0.83 | 30 | 4 | opposite-strand | Collagenase |
| 8 | PF00892.22 | 0.61 | 22 | 4860.0 | same-strand | EamA-like transporter family |
| 9 | PF00165.25 | 0.64 | 23 | 3812.0 | opposite-strand | Bacterial regulatory helix-turn-helix proteins, AraC family |
| 10 | PF12833.9 | 0.64 | 23 | 3812.0 | opposite-strand | Helix-turn-helix domain |
++ More..