Result : P64456
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YdcY |
| NCBI Accession ID | AE014075.1 |
| Organism | Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) |
| Left | 1707943 |
| Right | 1708176 |
| Strand | + |
| Nucleotide Sequence | ATGTCGCATCTGGATGAAGTCATCGCGCGCGTGGATGCCGCGATTGAAGAGAGCGTCATTGCCCATATGAACGAATTATTAATCGCCCTGAGCGATGACGCGGAGTTAAGTCGGGAAGATCGCTACACCCAGCAGCAGCGTTTGCGCACCGCTATTGCTCATCACGGTCGCAAACATAAAGAAGATATGGAAGCGCGCCACGAACAGTTAACCAAAGGCGGTACCATCCTCTGA |
| Sequence | MSHLDEVIARVDAAIEESVIAHMNELLIALSDDAELSREDRYTQQQRLRTAIAHHGRKHKEDMEARHEQLTKGGTIL |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of pfam10735. Profile Description: Protein of unknown function (DUF2526). This family of proteins with unknown function is restricted to Enterobacteriaceae. The family has a highly conserved sequence. |
| Pubmed ID | 12471157 |
| Domain | CDD:402390 |
| Functional Category | Others |
| Uniprot ID | P64456 |
| ORF Length (Amino Acid) | 77 |
++ More..
| Conservation Analysis |
No. of Species: 59
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2248783 | 2249016 | - | NZ_LR134340.1 | Escherichia marmotae |
| 2 | 1808748 | 1808981 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 3 | 1517648 | 1517881 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 4 | 2033548 | 2033781 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 5 | 1505269 | 1505502 | + | NZ_AP014857.1 | Escherichia albertii |
| 6 | 480350 | 480583 | + | NZ_CP057657.1 | Escherichia fergusonii |
| 7 | 1438870 | 1439103 | + | NC_009792.1 | Citrobacter koseri ATCC BAA-895 |
| 8 | 1687025 | 1687258 | - | NC_013716.1 | Citrobacter rodentium ICC168 |
| 9 | 350205 | 350438 | - | NZ_AP019007.1 | Enterobacter oligotrophicus |
| 10 | 3838316 | 3838549 | - | NZ_LT556085.1 | Citrobacter amalonaticus |
| 11 | 2451856 | 2452089 | - | NZ_AP022508.1 | Enterobacter bugandensis |
| 12 | 4828660 | 4828893 | + | NZ_CP044098.1 | Citrobacter portucalensis |
| 13 | 180191 | 180424 | - | NZ_CP033744.1 | Citrobacter freundii |
| 14 | 3105598 | 3105831 | + | NZ_CP045205.1 | Citrobacter telavivensis |
| 15 | 2252304 | 2252537 | + | NZ_CP012871.1 | [Enterobacter] lignolyticus |
| 16 | 2447545 | 2447778 | - | NZ_CP017184.1 | Enterobacter roggenkampii |
| 17 | 2476604 | 2476837 | - | NC_015968.1 | Enterobacter soli |
| 18 | 2476965 | 2477198 | - | NZ_CP009756.1 | Enterobacter cloacae |
| 19 | 61175 | 61408 | + | NZ_CP025034.2 | Enterobacter sp. SGAir0187 |
| 20 | 996467 | 996700 | - | NZ_CP038469.1 | Citrobacter tructae |
| 21 | 995687 | 995920 | + | NZ_CP045769.1 | Enterobacter cancerogenus |
| 22 | 2454244 | 2454477 | - | NZ_CP027986.1 | Enterobacter sichuanensis |
| 23 | 2704134 | 2704367 | - | NZ_CP043318.1 | Enterobacter chengduensis |
| 24 | 2677164 | 2677397 | + | NZ_CP014007.2 | Kosakonia oryzae |
| 25 | 1679308 | 1679541 | - | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
| 26 | 2505016 | 2505249 | - | NZ_CP015113.1 | Kosakonia radicincitans |
| 27 | 646185 | 646418 | + | NZ_CP045300.1 | Kosakonia arachidis |
| 28 | 1256016 | 1256249 | - | NZ_CP023529.1 | Lelliottia amnigena |
| 29 | 4079720 | 4079953 | - | NZ_CP053416.1 | Salmonella bongori |
| 30 | 1685106 | 1685339 | - | NZ_CP017279.1 | Enterobacter ludwigii |
| 31 | 1898296 | 1898529 | - | NZ_CP011602.1 | Phytobacter ursingii |
| 32 | 3113379 | 3113612 | + | NZ_CP051548.1 | Phytobacter diazotrophicus |
| 33 | 2455128 | 2455361 | - | NZ_CP063425.1 | Kosakonia pseudosacchari |
| 34 | 663653 | 663886 | + | NZ_CP016337.1 | Kosakonia sacchari |
| 35 | 2347553 | 2347786 | + | NZ_CP065838.1 | Klebsiella quasipneumoniae |
| 36 | 3089868 | 3090101 | - | NZ_CP050508.1 | Raoultella terrigena |
| 37 | 2892062 | 2892295 | - | NC_016845.1 | Klebsiella pneumoniae subsp. pneumoniae HS11286 |
| 38 | 2431010 | 2431243 | + | NZ_CP054254.1 | Klebsiella variicola |
| 39 | 3198518 | 3198751 | - | NZ_CP060111.1 | Klebsiella michiganensis |
| 40 | 4314294 | 4314527 | + | NZ_CP026047.1 | Raoultella planticola |
| 41 | 2963778 | 2964011 | - | NZ_CP046672.1 | Raoultella ornithinolytica |
| 42 | 2407735 | 2407968 | + | NZ_LR134475.1 | Klebsiella aerogenes |
| 43 | 3919070 | 3919315 | - | NZ_CP040428.1 | Jejubacter calystegiae |
| 44 | 3141097 | 3141330 | - | NZ_CP036175.1 | Klebsiella huaxiensis |
| 45 | 2317215 | 2317448 | + | NZ_CP013990.1 | Leclercia adecarboxylata |
| 46 | 2722787 | 2723020 | - | NZ_CP041247.1 | Raoultella electrica |
| 47 | 2327285 | 2327518 | - | NZ_CP054058.1 | Scandinavium goeteborgense |
| 48 | 2351492 | 2351725 | + | NZ_CP035129.1 | Kosakonia cowanii |
| 49 | 3430545 | 3430778 | + | NZ_CP020388.1 | Pluralibacter gergoviae |
| 50 | 2334654 | 2334887 | - | NZ_CP045845.1 | Kluyvera intermedia |
| 51 | 1952239 | 1952484 | - | NZ_CP012268.1 | Cronobacter muytjensii ATCC 51329 |
| 52 | 2046690 | 2046935 | + | NZ_CP012264.1 | Cronobacter condimenti 1330 |
| 53 | 2113979 | 2114224 | + | NZ_CP012266.1 | Cronobacter dublinensis subsp. dublinensis LMG 23823 |
| 54 | 2110887 | 2111132 | + | NZ_CP012257.1 | Cronobacter universalis NCTC 9529 |
| 55 | 2106450 | 2106695 | - | NZ_CP013940.1 | Cronobacter malonaticus LMG 23826 |
| 56 | 2358003 | 2358236 | - | NZ_LR134201.1 | Cedecea lapagei |
| 57 | 1325687 | 1325932 | - | NZ_CP027107.1 | Cronobacter sakazakii |
| 58 | 3961904 | 3962149 | - | NZ_CP042941.1 | Atlantibacter hermannii |
| 59 | 2234572 | 2234805 | + | NZ_CP023525.1 | Cedecea neteri |
| 60 | 2086389 | 2086634 | - | NC_017910.1 | Shimwellia blattae DSM 4481 = NBRC 105725 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_009792.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF16884.7 | 0.86 | 51 | 1753.0 | same-strand | N-terminal domain of oxidoreductase |
| 2 | PF00107.28 | 0.88 | 52 | 1753 | same-strand | Zinc-binding dehydrogenase |
| 3 | PF13602.8 | 0.88 | 52 | 1753 | same-strand | Zinc-binding dehydrogenase |
| 4 | PF00583.27 | 0.93 | 55 | 454 | opposite-strand | Acetyltransferase (GNAT) family |
| 5 | PF13420.9 | 0.93 | 55 | 453.5 | opposite-strand | Acetyltransferase (GNAT) domain |
| 6 | PF13302.9 | 0.93 | 55 | 453.5 | opposite-strand | Acetyltransferase (GNAT) domain |
| 7 | PF13508.9 | 0.93 | 55 | 454 | opposite-strand | Acetyltransferase (GNAT) domain |
| 8 | PF04657.15 | 0.9 | 53 | 6.5 | opposite-strand | Putative inner membrane exporter, YdcZ |
| 9 | PF07520.13 | 0.68 | 40 | 3286.5 | opposite-strand | Virulence factor SrfB |
| 10 | PF00496.24 | 0.81 | 48 | 18.0 | same-strand | Bacterial extracellular solute-binding proteins, family 5 Middle |
| 11 | PF01381.24 | 0.8 | 47 | 1119 | same-strand | Helix-turn-helix |
| 12 | PF13560.8 | 0.78 | 46 | 1120.5 | same-strand | Helix-turn-helix domain |
| 13 | PF12844.9 | 0.8 | 47 | 1119 | same-strand | Helix-turn-helix domain |
| 14 | PF13443.8 | 0.75 | 44 | 1120.5 | same-strand | Cro/C1-type HTH DNA-binding domain |
++ More..