Result : P64454
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Orphan toxin OrtT |
| NCBI Accession ID | |
| Organism | Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | |
| Sequence | MSLYQHMLVFYAVMAAIAFLITWFLSHDKKRIRFLSAFLVGATWPMSFPVALLFSLF |
| Source of smORF | Swiss-Prot |
| Function | Acts as an orphan toxin which is important for maintaining cell fitness during stress related to the stringent response. Increases the formation of persister cells. Has no known antitoxin. {ECO:0000250|UniProtKB:P64453}. |
| Pubmed ID | 12471157 |
| Domain | CDD:402401 |
| Functional Category | Others |
| Uniprot ID | P64454 |
| ORF Length (Amino Acid) | 57 |
++ More..
| Conservation Analysis |
No. of Species: 71
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2027136 | 2027309 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 2 | 1517389 | 1517562 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 3 | 4352908 | 4353081 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 4 | 2033289 | 2033462 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 5 | 5207485 | 5207658 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 6 | 1809067 | 1809240 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 7 | 3846886 | 3847059 | - | NZ_LT556085.1 | Citrobacter amalonaticus |
| 8 | 3097080 | 3097253 | + | NZ_CP045205.1 | Citrobacter telavivensis |
| 9 | 4086685 | 4086858 | - | NZ_CP053416.1 | Salmonella bongori |
| 10 | 1693916 | 1694089 | - | NC_013716.1 | Citrobacter rodentium ICC168 |
| 11 | 1430257 | 1430430 | + | NC_009792.1 | Citrobacter koseri ATCC BAA-895 |
| 12 | 636349 | 636522 | + | NZ_CP045300.1 | Kosakonia arachidis |
| 13 | 636736 | 636909 | + | NZ_CP045300.1 | Kosakonia arachidis |
| 14 | 2667452 | 2667625 | + | NZ_CP014007.2 | Kosakonia oryzae |
| 15 | 2667714 | 2667887 | + | NZ_CP014007.2 | Kosakonia oryzae |
| 16 | 2514788 | 2514961 | - | NZ_CP015113.1 | Kosakonia radicincitans |
| 17 | 2514526 | 2514699 | - | NZ_CP015113.1 | Kosakonia radicincitans |
| 18 | 2307619 | 2307792 | + | NZ_CP013990.1 | Leclercia adecarboxylata |
| 19 | 359721 | 359894 | - | NZ_AP019007.1 | Enterobacter oligotrophicus |
| 20 | 188795 | 188968 | - | NZ_CP033744.1 | Citrobacter freundii |
| 21 | 1686256 | 1686429 | - | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
| 22 | 2713814 | 2713987 | - | NZ_CP043318.1 | Enterobacter chengduensis |
| 23 | 2461423 | 2461596 | - | NZ_AP022508.1 | Enterobacter bugandensis |
| 24 | 2341721 | 2341894 | + | NZ_CP035129.1 | Kosakonia cowanii |
| 25 | 2341999 | 2342172 | + | NZ_CP035129.1 | Kosakonia cowanii |
| 26 | 2464903 | 2465076 | - | NZ_CP063425.1 | Kosakonia pseudosacchari |
| 27 | 2464633 | 2464806 | - | NZ_CP063425.1 | Kosakonia pseudosacchari |
| 28 | 4820116 | 4820289 | + | NZ_CP044098.1 | Citrobacter portucalensis |
| 29 | 1272574 | 1272747 | - | NZ_CP023529.1 | Lelliottia amnigena |
| 30 | 987006 | 987179 | + | NZ_CP045769.1 | Enterobacter cancerogenus |
| 31 | 2463894 | 2464067 | - | NZ_CP027986.1 | Enterobacter sichuanensis |
| 32 | 2457183 | 2457356 | - | NZ_CP017184.1 | Enterobacter roggenkampii |
| 33 | 51596 | 51769 | + | NZ_CP025034.2 | Enterobacter sp. SGAir0187 |
| 34 | 2486582 | 2486755 | - | NZ_CP009756.1 | Enterobacter cloacae |
| 35 | 1694660 | 1694833 | - | NZ_CP017279.1 | Enterobacter ludwigii |
| 36 | 653938 | 654111 | + | NZ_CP016337.1 | Kosakonia sacchari |
| 37 | 654208 | 654381 | + | NZ_CP016337.1 | Kosakonia sacchari |
| 38 | 1907307 | 1907480 | - | NZ_CP011602.1 | Phytobacter ursingii |
| 39 | 1907029 | 1907202 | - | NZ_CP011602.1 | Phytobacter ursingii |
| 40 | 2486156 | 2486329 | - | NC_015968.1 | Enterobacter soli |
| 41 | 1005057 | 1005230 | - | NZ_CP038469.1 | Citrobacter tructae |
| 42 | 2249102 | 2249275 | - | NZ_LR134340.1 | Escherichia marmotae |
| 43 | 378895 | 379068 | + | NZ_LR134340.1 | Escherichia marmotae |
| 44 | 3419519 | 3419692 | + | NZ_CP020388.1 | Pluralibacter gergoviae |
| 45 | 2555455 | 2555628 | - | NZ_CP020388.1 | Pluralibacter gergoviae |
| 46 | 3104445 | 3104618 | + | NZ_CP051548.1 | Phytobacter diazotrophicus |
| 47 | 3104723 | 3104896 | + | NZ_CP051548.1 | Phytobacter diazotrophicus |
| 48 | 546773 | 546946 | + | NZ_CP057657.1 | Escherichia fergusonii |
| 49 | 2436735 | 2436908 | - | NZ_CP023525.1 | Cedecea neteri |
| 50 | 1737180 | 1737353 | + | NZ_CP012268.1 | Cronobacter muytjensii ATCC 51329 |
| 51 | 2322921 | 2323094 | - | NZ_CP012266.1 | Cronobacter dublinensis subsp. dublinensis LMG 23823 |
| 52 | 1505010 | 1505183 | + | NZ_AP014857.1 | Escherichia albertii |
| 53 | 2228801 | 2228974 | + | NZ_LR134201.1 | Cedecea lapagei |
| 54 | 1890599 | 1890772 | + | NZ_CP013940.1 | Cronobacter malonaticus LMG 23826 |
| 55 | 2332024 | 2332197 | - | NZ_CP012257.1 | Cronobacter universalis NCTC 9529 |
| 56 | 1121100 | 1121273 | + | NZ_CP027107.1 | Cronobacter sakazakii |
| 57 | 2258301 | 2258474 | + | NZ_AP023184.1 | Buttiauxella agrestis |
| 58 | 248541 | 248714 | + | NC_017553.1 | Pantoea ananatis PA13 |
| 59 | 2261355 | 2261528 | - | NZ_CP012264.1 | Cronobacter condimenti 1330 |
| 60 | 2340108 | 2340281 | - | NZ_CP054058.1 | Scandinavium goeteborgense |
| 61 | 136724 | 136897 | - | NZ_CP034149.1 | Pantoea agglomerans |
| 62 | 213523 | 213696 | - | NZ_CP049116.1 | Pantoea stewartii |
| 63 | 347961 | 348134 | - | NZ_CP045721.1 | Pantoea eucalypti |
| 64 | 358620 | 358793 | + | NZ_CP038854.1 | Pantoea vagans |
| 65 | 3566534 | 3566707 | + | NZ_CP042941.1 | Atlantibacter hermannii |
| 66 | 4493914 | 4494087 | - | NZ_CP040428.1 | Jejubacter calystegiae |
| 67 | 2402581 | 2402754 | + | NZ_LR134475.1 | Klebsiella aerogenes |
| 68 | 3055003 | 3055176 | - | NC_017910.1 | Shimwellia blattae DSM 4481 = NBRC 105725 |
| 69 | 2896464 | 2896637 | - | NC_016845.1 | Klebsiella pneumoniae subsp. pneumoniae HS11286 |
| 70 | 2426669 | 2426842 | + | NZ_CP054254.1 | Klebsiella variicola |
| 71 | 3145528 | 3145701 | - | NZ_CP036175.1 | Klebsiella huaxiensis |
| 72 | 2242936 | 2243109 | + | NZ_CP012871.1 | [Enterobacter] lignolyticus |
| 73 | 2343208 | 2343381 | + | NZ_CP065838.1 | Klebsiella quasipneumoniae |
| 74 | 3204253 | 3204426 | - | NZ_CP060111.1 | Klebsiella michiganensis |
| 75 | 2392209 | 2392382 | - | NZ_CP045845.1 | Kluyvera intermedia |
| 76 | 2727285 | 2727458 | - | NZ_CP041247.1 | Raoultella electrica |
| 77 | 4309705 | 4309878 | + | NZ_CP026047.1 | Raoultella planticola |
| 78 | 2968426 | 2968599 | - | NZ_CP046672.1 | Raoultella ornithinolytica |
| 79 | 3094272 | 3094445 | - | NZ_CP050508.1 | Raoultella terrigena |
| 80 | 4509734 | 4509877 | + | NZ_CP047495.1 | Pectobacterium brasiliense |
| 81 | 2844377 | 2844556 | + | NZ_CP006569.1 | Sodalis praecaptivus |
| 82 | 67169 | 67348 | + | NZ_CP026364.1 | Proteus hauseri |
| 83 | 2069888 | 2070049 | + | NZ_CP016043.1 | Edwardsiella hoshinae |
| 84 | 120564 | 120725 | + | NZ_CP023706.1 | Edwardsiella tarda |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP061527.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00171.24 | 0.65 | 46 | 1104.5 | same-strand | Aldehyde dehydrogenase family |
++ More..