Result : P64445
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YnaJ |
| NCBI Accession ID | U00096.3 |
| Organism | Escherichia coli (strain K12) |
| Left | 1397365 |
| Right | 1397622 |
| Strand | + |
| Nucleotide Sequence | ATGATTATGGCGAAACTGAAGTCAGCGAAAGGGAAGAAATTTCTCTTTGGTTTGTTGGCGGTTTTCATTATTGCGGCGTCGGTTGTGACTCGCGCGACCATCGGCGGCGTTATAGAACAGTACAATATTCCGCTGTCTGAGTGGACGACATCAATGTATGTGATTCAGTCATCGATGATTTTTGTTTATAGCCTGGTCTTTACTGTGTTGCTGGCAATCCCGTTGGGAATTTATTTCCTTGGCGGCGAAGAGCAGTAA |
| Sequence | MIMAKLKSAKGKKFLFGLLAVFIIAASVVTRATIGGVIEQYNIPLSEWTTSMYVIQSSMIFVYSLVFTVLLAIPLGIYFLGGEEQ |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of pfam10749. Profile Description: Protein of unknown function (DUF2534). This family of proteins with unknown function appears to be restricted to Enterobacteriaceae. |
| Pubmed ID | 9278503 16738553 |
| Domain | CDD:402400 |
| Functional Category | Others |
| Uniprot ID | P64445 |
| ORF Length (Amino Acid) | 85 |
++ More..
| Conservation Analysis |
No. of Species: 41
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1397365 | 1397622 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 2 | 1905661 | 1905918 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 3 | 2355273 | 2355530 | - | NZ_LR134340.1 | Escherichia marmotae |
| 4 | 1442980 | 1443237 | + | NZ_AP014857.1 | Escherichia albertii |
| 5 | 3941780 | 3942040 | - | NZ_LT556085.1 | Citrobacter amalonaticus |
| 6 | 1362035 | 1362295 | + | NC_009792.1 | Citrobacter koseri ATCC BAA-895 |
| 7 | 1756273 | 1756527 | - | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
| 8 | 3006722 | 3006982 | + | NZ_CP045205.1 | Citrobacter telavivensis |
| 9 | 4736543 | 4736803 | + | NZ_CP044098.1 | Citrobacter portucalensis |
| 10 | 4169951 | 4170211 | - | NZ_CP053416.1 | Salmonella bongori |
| 11 | 323346 | 323606 | - | NZ_CP033744.1 | Citrobacter freundii |
| 12 | 1783943 | 1784203 | - | NC_013716.1 | Citrobacter rodentium ICC168 |
| 13 | 1085440 | 1085700 | - | NZ_CP038469.1 | Citrobacter tructae |
| 14 | 678563 | 678823 | - | NZ_CP057657.1 | Escherichia fergusonii |
| 15 | 952893 | 953153 | - | NZ_AP019007.1 | Enterobacter oligotrophicus |
| 16 | 3178213 | 3178473 | - | NZ_AP022508.1 | Enterobacter bugandensis |
| 17 | 3209697 | 3209957 | - | NZ_CP027986.1 | Enterobacter sichuanensis |
| 18 | 3489452 | 3489712 | - | NZ_CP043318.1 | Enterobacter chengduensis |
| 19 | 3315376 | 3315636 | - | NZ_CP009756.1 | Enterobacter cloacae |
| 20 | 2464197 | 2464457 | - | NZ_CP017279.1 | Enterobacter ludwigii |
| 21 | 4076742 | 4077002 | + | NZ_CP025034.2 | Enterobacter sp. SGAir0187 |
| 22 | 3169458 | 3169718 | - | NC_015968.1 | Enterobacter soli |
| 23 | 3206743 | 3207003 | - | NZ_CP017184.1 | Enterobacter roggenkampii |
| 24 | 1967473 | 1967733 | - | NZ_CP023529.1 | Lelliottia amnigena |
| 25 | 307672 | 307932 | + | NZ_CP045769.1 | Enterobacter cancerogenus |
| 26 | 1521896 | 1522156 | + | NZ_CP013990.1 | Leclercia adecarboxylata |
| 27 | 2107093 | 2107356 | + | NZ_LR134475.1 | Klebsiella aerogenes |
| 28 | 4036216 | 4036476 | + | NZ_CP019706.1 | Pantoea alhagi |
| 29 | 3090615 | 3090878 | - | NZ_CP065838.1 | Klebsiella quasipneumoniae |
| 30 | 3325403 | 3325666 | - | NZ_CP054254.1 | Klebsiella variicola |
| 31 | 2404792 | 2405055 | - | NZ_CP026377.1 | Mixta gaviniae |
| 32 | 1497621 | 1497881 | - | NZ_CP028271.1 | Mixta intestinalis |
| 33 | 2303324 | 2303587 | - | NZ_CP061511.1 | Mixta calida |
| 34 | 2107209 | 2107472 | + | NC_016845.1 | Klebsiella pneumoniae subsp. pneumoniae HS11286 |
| 35 | 1970226 | 1970486 | + | NZ_CP012871.1 | [Enterobacter] lignolyticus |
| 36 | 3496337 | 3496600 | - | NZ_CP036175.1 | Klebsiella huaxiensis |
| 37 | 3484211 | 3484474 | - | NZ_CP050508.1 | Raoultella terrigena |
| 38 | 3878573 | 3878836 | + | NZ_CP026047.1 | Raoultella planticola |
| 39 | 3367664 | 3367927 | - | NZ_CP046672.1 | Raoultella ornithinolytica |
| 40 | 3148517 | 3148780 | - | NZ_CP041247.1 | Raoultella electrica |
| 41 | 2655388 | 2655648 | - | NZ_CP045845.1 | Kluyvera intermedia |
| 42 | 3621508 | 3621771 | - | NZ_CP060111.1 | Klebsiella michiganensis |
++ More..