Protein Information |
Information Type | Description |
---|---|
Protein name | Cell division protein FtsB |
NCBI Accession ID | AL157959.1 |
Organism | Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491) |
Left | 1394250 |
Right | 1394528 |
Strand | + |
Nucleotide Sequence | ATGAAGTGGGTAACTGTCGTTTTATCCTTCGCACTTGTCTGTTGCCAATACAGCCTCTGGTTCGGCAAAGGCAGCATCGGACGCAACAGCAGTCTGAGAGAACAGATTGCCGTTCAAGAAGAAAAAAACCAGACACTCGCCCTACGCAATCATTCCCTTGCCGCCGAAGTCTATGATTTGGAAAACGGTCAAGAAGCCATTTCGGAAATCGCCCGGGTAGAACTGGGTTATATCCAAGACGGTGAAACCTTTTACCGACTCATCAGGCATAACCGGTAA |
Sequence | MKWVTVVLSFALVCCQYSLWFGKGSIGRNSSLREQIAVQEEKNQTLALRNHSLAAEVYDLENGQEAISEIARVELGYIQDGETFYRLIRHNR |
Source of smORF | Swiss-Prot |
Function | Essential cell division protein. May link together the upstream cell division proteins, which are predominantly cytoplasmic, with the downstream cell division proteins, which are predominantly periplasmic. {ECO:0000255|HAMAP-Rule:MF_00599}. |
Pubmed ID | 10761919 |
Domain | CDD:416267 |
Functional Category | Others |
Uniprot ID | P64160 |
ORF Length (Amino Acid) | 92 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 85198 | 85476 | + | NZ_CP012028.1 | Neisseria gonorrhoeae |
2 | 871876 | 872154 | + | NZ_CP021520.1 | Neisseria meningitidis |
3 | 168226 | 168504 | + | NZ_CP031325.1 | Neisseria polysaccharea |
4 | 962565 | 962843 | + | NZ_CP031253.1 | Neisseria lactamica |
5 | 787919 | 788197 | + | NZ_LS483369.1 | Neisseria cinerea |
6 | 748490 | 748768 | - | NZ_CP072524.1 | Neisseria sicca |
7 | 2453362 | 2453640 | + | NZ_CP046027.1 | Neisseria brasiliensis |
8 | 2051747 | 2052025 | - | NZ_CP031699.1 | Neisseria animalis |
9 | 552982 | 553257 | - | NZ_CP039887.1 | Neisseria subflava |
10 | 497407 | 497682 | - | NZ_CP039886.1 | Neisseria flavescens |
11 | 437990 | 438265 | - | NZ_CP022278.1 | Neisseria chenwenguii |
12 | 1693918 | 1694193 | - | NZ_LR134516.1 | Neisseria animaloris |
13 | 2256209 | 2256484 | + | NZ_LT906434.1 | Neisseria zoodegmatis |
14 | 368948 | 369223 | + | NZ_LR134533.1 | Neisseria weaveri |
15 | 2398677 | 2398949 | - | NZ_CP031700.1 | Neisseria zalophi |
16 | 1571599 | 1571874 | - | NZ_CP060414.1 | Neisseria musculi |
17 | 1140919 | 1141197 | + | NZ_CP031252.1 | Neisseria elongata |
18 | 1325077 | 1325358 | + | NZ_LR134313.1 | Neisseria canis |
19 | 2398282 | 2398563 | - | NZ_CP059565.1 | Neisseria wadsworthii |
20 | 1215899 | 1216177 | - | NZ_CP059571.1 | Neisseria bacilliformis |
21 | 1714816 | 1715064 | + | NZ_CP012373.2 | Beggiatoa leptomitoformis |
22 | 1895703 | 1895984 | - | NZ_AP018689.1 | Vibrio aphrogenes |
23 | 866830 | 867126 | - | NZ_CP011104.1 | Photorhabdus thracensis |
24 | 3818614 | 3818883 | - | NC_009792.1 | Citrobacter koseri ATCC BAA-895 |
25 | 4208514 | 4208744 | + | NZ_CP016176.1 | Xenorhabdus hominickii |
26 | 581099 | 581386 | + | NZ_CP059567.1 | Neisseria shayeganii |
27 | 886990 | 887280 | - | NZ_CP053416.1 | Salmonella bongori |
28 | 4365160 | 4365480 | + | NZ_CP067057.1 | Rahnella aceris |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00113.24 | 0.79 | 22 | 15.5 | same-strand | Enolase, C-terminal TIM barrel domain |
2 | PF03952.18 | 0.79 | 22 | 15.5 | same-strand | Enolase, N-terminal domain |