Result : P63878
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Translational regulator CsrA (Carbon storage regulator) |
| NCBI Accession ID | AE009442.1 |
| Organism | Xylella fastidiosa (strain Temecula1 / ATCC 700964) |
| Left | 122156 |
| Right | 122371 |
| Strand | + |
| Nucleotide Sequence | ATGTTGATCCTGACTCGTCGTTCTGGTGAAACGTTGATGATAGGTGATCAGGTCACCGTAACGGTGCTTGGTGTAAAGGGTAACCAAGTGCGTGTTGGTATCAATGCTCCTAAGCATGTGGCAGTGCATCGTGAAGAGATCTATCATCGTATTCAGCGTGGTGACGAGCTTGCGTGTTCTTCTGGAACGCGGGGAGATAGCGGCTCTTCCATATAA |
| Sequence | MLILTRRSGETLMIGDQVTVTVLGVKGNQVRVGINAPKHVAVHREEIYHRIQRGDELACSSGTRGDSGSSI |
| Source of smORF | Swiss-Prot |
| Function | A key translational regulator that binds mRNA to regulate translation initiation and/or mRNA stability. Mediates global changes in gene expression, shifting from rapid growth to stress survival by linking envelope stress, the stringent response and the catabolite repression systems. Usually binds in the 5'-UTR; binding at or near the Shine-Dalgarno sequence prevents ribosome-binding, repressing translation, binding elsewhere in the 5'-UTR can activate translation and/or stabilize the mRNA. Its function is antagonized by small RNA(s). {ECO:0000255|HAMAP-Rule:MF_00167}. |
| Pubmed ID | 12533478 |
| Domain | CDD:412510 |
| Functional Category | RNA-binding |
| Uniprot ID | P63878 |
| ORF Length (Amino Acid) | 71 |
++ More..
| Conservation Analysis |
No. of Species: 120
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 122156 | 122371 | + | NC_004556.1 | Xylella fastidiosa Temecula1 |
| 2 | 144650 | 144865 | + | NZ_CP053627.1 | Xylella taiwanensis |
| 3 | 2901800 | 2902012 | - | NZ_CP028127.1 | Xanthomonas vasicola pv. vasculorum |
| 4 | 491088 | 491300 | + | NZ_CP016878.1 | Xanthomonas hortorum |
| 5 | 2450879 | 2451091 | - | NZ_CP007810.1 | Xanthomonas oryzae pv. oryzicola |
| 6 | 2031677 | 2031889 | + | NZ_CP072268.1 | Xanthomonas euvesicatoria pv. alfalfae |
| 7 | 2033385 | 2033597 | + | NZ_CP048044.1 | Xanthomonas citri |
| 8 | 1717035 | 1717247 | + | NZ_CP033326.1 | Xanthomonas cucurbitae |
| 9 | 5057715 | 5057927 | + | NZ_CP018725.1 | Xanthomonas vesicatoria ATCC 35937 |
| 10 | 2504254 | 2504466 | - | NZ_LT853882.1 | Xanthomonas fragariae |
| 11 | 541644 | 541847 | + | NZ_CP071517.1 | Lysobacter arenosi |
| 12 | 2903442 | 2903654 | - | NZ_CP058243.1 | Xanthomonas campestris pv. raphani |
| 13 | 1722451 | 1722654 | + | NZ_CP037883.1 | Stenotrophomonas indicatrix |
| 14 | 2290954 | 2291157 | + | NZ_CP011129.1 | Lysobacter antibioticus |
| 15 | 3538344 | 3538547 | - | NZ_CP011131.1 | Lysobacter gummosus |
| 16 | 2192773 | 2192976 | + | NZ_AP014940.1 | Lysobacter enzymogenes |
| 17 | 2227611 | 2227814 | + | NZ_CP023465.1 | Lysobacter capsici |
| 18 | 4150342 | 4150557 | + | NZ_CP043476.1 | Xanthomonas hyacinthi |
| 19 | 1442260 | 1442466 | + | NZ_CP046603.1 | Lysobacter soli |
| 20 | 2613548 | 2613751 | - | NZ_CP012900.1 | Stenotrophomonas acidaminiphila |
| 21 | 3504296 | 3504505 | - | NZ_CP060731.1 | Pseudoxanthomonas mexicana |
| 22 | 3083641 | 3083844 | + | NZ_CP017480.1 | Luteibacter rhizovicinus DSM 16549 |
| 23 | 1265487 | 1265696 | + | NC_016147.2 | Pseudoxanthomonas spadix BD-a59 |
| 24 | 686629 | 686814 | + | NZ_CP016043.1 | Edwardsiella hoshinae |
| 25 | 1322888 | 1323100 | - | NZ_CP012418.1 | Kangiella sediminilitoris |
| 26 | 1322372 | 1322599 | - | NZ_CP012418.1 | Kangiella sediminilitoris |
| 27 | 2570173 | 2570373 | - | NZ_CP029843.1 | Lysobacter maris |
| 28 | 617514 | 617726 | - | NZ_CP042218.1 | Luteimonas granuli |
| 29 | 223320 | 223502 | + | NZ_CP012362.1 | Oblitimonas alkaliphila |
| 30 | 1387472 | 1387666 | + | NC_011901.1 | Thioalkalivibrio sulfidiphilus HL-EbGr7 |
| 31 | 632001 | 632201 | + | NZ_CP065435.1 | Halomonas sp. SS10-MC5 |
| 32 | 704392 | 704595 | + | NZ_CP013106.1 | Halomonas huangheensis |
| 33 | 671179 | 671376 | - | NZ_CP048812.1 | Halomonas socia |
| 34 | 2382215 | 2382409 | + | NZ_CP014143.1 | Microbulbifer aggregans |
| 35 | 1691477 | 1691671 | + | NC_007912.1 | Saccharophagus degradans 2-40 |
| 36 | 1749622 | 1749825 | - | NZ_AP018560.1 | Aerosticca soli |
| 37 | 4664583 | 4664768 | - | NZ_CP048878.1 | Spartinivicinus ruber |
| 38 | 4019456 | 4019653 | + | NZ_CP048711.1 | Kineobactrum salinum |
| 39 | 1441082 | 1441297 | - | NZ_CP025120.1 | Kangiella profundi |
| 40 | 1541123 | 1541338 | - | NC_013166.1 | Kangiella koreensis DSM 16069 |
| 41 | 3000079 | 3000279 | - | NZ_CP046268.1 | Vibrio spartinae |
| 42 | 2904903 | 2905097 | - | NZ_CP019650.1 | Microbulbifer agarilyticus |
| 43 | 3399303 | 3399500 | - | NZ_CP041036.1 | Shewanella polaris |
| 44 | 705009 | 705206 | + | NC_007963.1 | Chromohalobacter salexigens DSM 3043 |
| 45 | 1071867 | 1072064 | + | NC_003910.7 | Colwellia psychrerythraea 34H |
| 46 | 852822 | 853019 | + | NZ_CP070624.1 | Photobacterium damselae subsp. damselae |
| 47 | 1271214 | 1271408 | + | NC_008700.1 | Shewanella amazonensis SB2B |
| 48 | 3436869 | 3437066 | - | NZ_CP022358.1 | Shewanella bicestrii |
| 49 | 1619978 | 1620175 | + | NZ_CP034015.1 | Shewanella livingstonensis |
| 50 | 1255913 | 1256110 | + | NC_008345.1 | Shewanella frigidimarina NCIMB 400 |
| 51 | 1455613 | 1455810 | + | NC_009901.1 | Shewanella pealeana ATCC 700345 |
| 52 | 1502439 | 1502636 | + | NC_010334.1 | Shewanella halifaxensis HAW-EB4 |
| 53 | 3791918 | 3792115 | - | NC_016901.1 | Shewanella baltica OS678 |
| 54 | 2697560 | 2697760 | + | NZ_CP018632.1 | Granulosicoccus antarcticus IMCC3135 |
| 55 | 6146081 | 6146293 | - | NZ_CP018632.1 | Granulosicoccus antarcticus IMCC3135 |
| 56 | 1120059 | 1120268 | + | NZ_CP018632.1 | Granulosicoccus antarcticus IMCC3135 |
| 57 | 1435794 | 1436015 | + | NC_019902.2 | Thioalkalivibrio nitratireducens DSM 14787 |
| 58 | 533014 | 533211 | + | NZ_CP071325.1 | Photobacterium ganghwense |
| 59 | 918247 | 918441 | + | NZ_CP060084.1 | Teredinibacter haidensis |
| 60 | 1215045 | 1215251 | + | NZ_CP029556.1 | Lysobacter oculi |
| 61 | 822772 | 822993 | + | NC_017033.1 | Frateuria aurantia DSM 6220 |
| 62 | 2993967 | 2994164 | - | NZ_CP022272.1 | Shewanella marisflavi |
| 63 | 1150262 | 1150456 | + | NZ_CP069213.1 | Shewanella litorisediminis |
| 64 | 2379607 | 2379792 | + | NZ_CP023706.1 | Edwardsiella tarda |
| 65 | 2587787 | 2587981 | + | NZ_CP060092.1 | Teredinibacter purpureus |
| 66 | 1159328 | 1159513 | + | NZ_CP014007.2 | Kosakonia oryzae |
| 67 | 985257 | 985460 | - | NZ_CP019343.1 | Oceanicoccus sagamiensis |
| 68 | 1015184 | 1015369 | + | NZ_CP035129.1 | Kosakonia cowanii |
| 69 | 3428623 | 3428811 | - | NC_018691.1 | Alcanivorax dieselolei B5 |
| 70 | 2688222 | 2688440 | - | NC_019940.1 | Thioflavicoccus mobilis 8321 |
| 71 | 707472 | 707672 | + | NC_011312.1 | Aliivibrio salmonicida LFI1238 |
| 72 | 1675771 | 1675968 | + | NZ_CP046378.1 | Shewanella algae |
| 73 | 1758386 | 1758583 | + | NZ_CP035467.1 | Methylotuvimicrobium buryatense |
| 74 | 1878623 | 1878820 | - | NZ_AP018689.1 | Vibrio aphrogenes |
| 75 | 3783040 | 3783225 | + | NZ_CP023536.1 | Providencia alcalifaciens |
| 76 | 1943945 | 1944130 | - | NZ_LS483422.1 | Providencia heimbachae |
| 77 | 5574877 | 5575074 | + | NZ_CP060111.1 | Klebsiella michiganensis |
| 78 | 1989182 | 1989403 | - | NZ_CP007029.1 | Thioalkalivibrio paradoxus ARh 1 |
| 79 | 2929340 | 2929546 | - | NZ_AP017928.1 | Methylocaldum marinum |
| 80 | 3951769 | 3951972 | + | NZ_CP037953.1 | Permianibacter aggregans |
| 81 | 206496 | 206693 | + | NZ_CP016414.1 | Vibrio scophthalmi |
| 82 | 1144894 | 1145085 | - | NZ_CP072133.1 | Pseudoalteromonas xiamenensis |
| 83 | 308991 | 309185 | - | NZ_CP022355.1 | Paraphotobacterium marinum |
| 84 | 2776020 | 2776211 | + | NZ_CP021376.1 | Oceanisphaera avium |
| 85 | 3358954 | 3359145 | - | NZ_CP012621.1 | Zobellella denitrificans |
| 86 | 2570967 | 2571164 | - | NC_016041.1 | Glaciecola nitratireducens FR1064 |
| 87 | 590447 | 590644 | + | NZ_CP040021.1 | Salinivibrio kushneri |
| 88 | 1107755 | 1107952 | + | NZ_CP031769.1 | Salinimonas sediminis |
| 89 | 742656 | 742847 | - | NZ_CP014476.1 | Methylomonas denitrificans |
| 90 | 1967888 | 1968094 | - | NZ_AP018725.1 | Sulfuriflexus mobilis |
| 91 | 3050107 | 3050304 | - | NZ_CP036422.1 | Halioglobus maricola |
| 92 | 2456348 | 2456560 | + | NZ_CP061081.1 | Marinomonas arctica |
| 93 | 810094 | 810300 | + | NC_022664.1 | Spiribacter curvatus |
| 94 | 883966 | 884163 | + | NZ_LN614827.1 | Legionella fallonii LLAP-10 |
| 95 | 1580416 | 1580646 | - | NZ_AP017372.2 | Halorhodospira halochloris |
| 96 | 2053644 | 2053847 | - | NZ_CP038254.1 | Legionella israelensis |
| 97 | 1162581 | 1162775 | + | NZ_LT906442.1 | Legionella waltersii |
| 98 | 1803837 | 1804052 | - | NC_008789.1 | Halorhodospira halophila SL1 |
| 99 | 3084920 | 3085144 | - | NZ_CP016268.1 | Woeseia oceani |
| 100 | 2146248 | 2146442 | - | NZ_CP016397.1 | Legionella clemsonensis |
| 101 | 573572 | 573772 | - | NZ_CP007445.1 | Gilliamella apicola |
| 102 | 1355534 | 1355731 | - | NZ_CP029822.1 | Entomomonas moraniae |
| 103 | 25321 | 25527 | - | NZ_CP060093.1 | Teredinibacter purpureus |
| 104 | 2358426 | 2358626 | - | NZ_CP048810.1 | Pseudomonas bijieensis |
| 105 | 2198610 | 2198795 | - | NZ_CP015031.1 | Basfia succiniciproducens |
| 106 | 325108 | 325293 | - | NC_006300.1 | [Mannheimia] succiniciproducens MBEL55E |
| 107 | 1824178 | 1824363 | + | NZ_CP070503.1 | Pseudomonas atacamensis |
| 108 | 1826154 | 1826354 | + | NZ_CP034725.1 | Pseudomonas brassicacearum |
| 109 | 993197 | 993409 | - | NC_002971.4 | Coxiella burnetii RSA 493 |
| 110 | 2088424 | 2088606 | - | NZ_CP016605.1 | Bisgaardia hudsonensis |
| 111 | 947004 | 947186 | - | NZ_LT906463.1 | Haemophilus pittmaniae |
| 112 | 758991 | 759185 | - | NZ_CP030753.1 | Actinobacillus pleuropneumoniae |
| 113 | 292737 | 292928 | - | NZ_LR134365.1 | Cardiobacterium hominis |
| 114 | 963666 | 963845 | - | NZ_CP016180.1 | Pasteurella skyensis |
| 115 | 95252 | 95440 | + | NZ_CP015425.1 | [Haemophilus] ducreyi |
| 116 | 1349119 | 1349313 | + | NZ_CP040863.1 | Rodentibacter heylii |
| 117 | 1144581 | 1144763 | + | NZ_CP006954.1 | Bibersteinia trehalosi USDA-ARS-USMARC-188 |
| 118 | 62804 | 63028 | - | NZ_CP025492.2 | Legionella sainthelensi |
| 119 | 2636505 | 2636720 | - | NZ_CP009416.1 | Jeotgalibacillus malaysiensis |
| 120 | 1959539 | 1959760 | - | NZ_CP031092.1 | Salicibibacter kimchii |
| 121 | 1808493 | 1808687 | + | NZ_CP007139.1 | Fimbriimonas ginsengisoli Gsoil 348 |
| 122 | 1902817 | 1903014 | - | NZ_AP020335.1 | Hydrogenovibrio marinus |
| 123 | 1150025 | 1150255 | + | NZ_CP045851.1 | Actinomarinicola tropica |
| 124 | 4735732 | 4735947 | - | NC_016627.1 | Acetivibrio clariflavus DSM 19732 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_004556.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00154.23 | 0.63 | 76 | 3691 | same-strand | recA bacterial DNA recombination protein |
| 2 | PF08423.13 | 0.63 | 76 | 3691 | same-strand | Rad51 |
| 3 | PF01411.21 | 0.82 | 99 | 284.0 | same-strand | tRNA synthetases class II (A) |
| 4 | PF02272.21 | 0.83 | 100 | 265 | same-strand | DHHA1 domain |
| 5 | PF07973.16 | 0.83 | 100 | 265 | same-strand | Threonyl and Alanyl tRNA synthetase second additional domain |
++ More..