Result : P62537
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Replication regulatory protein repA2 (Protein CopB) |
| NCBI Accession ID | AL391753.1 |
| Organism | Shigella flexneri |
| Left | 202555 |
| Right | 202815 |
| Strand | + |
| Nucleotide Sequence | ATGTCGCAGACAGAAAATGCAGTGACTTCCTCATTGAGTCAAAAGCGGTTTGTGCGCAGAGGTAAGCCTATGACTGACTCTGAGAAACAAATGGCCGCTGTTGCAAGAAAACGTCTTACACACAAAGAGATAAAAGTTTTTGTCAAAAATCCTCTGAAAGATCTCATGGTTGAGTACTGCGAGAGAGAGGGGATAACACAGGCTCAGTTCGTTGAGAAAATCATCAAAGATGAACTGCAGAGACTGGATATACTAAAGTAA |
| Sequence | MSQTENAVTSSLSQKRFVRRGKPMTDSEKQMAAVARKRLTHKEIKVFVKNPLKDLMVEYCEREGITQAQFVEKIIKDELQRLDILK |
| Source of smORF | Swiss-Prot |
| Function | This protein is involved in the determination of copy number in gene replication. It binds to the repA promoter thus inhibiting the synthesis of the mRNA for the initiator protein repA (By similarity). {ECO:0000250}. |
| Pubmed ID | 11115111 11292750 12384590 14573649 |
| Domain | CDD:332665 |
| Functional Category | DNA-binding |
| Uniprot ID | P62537 |
| ORF Length (Amino Acid) | 86 |
++ More..
| Conservation Analysis |
No. of Species: 7
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 208897 | 209157 | + | NC_004851.1 | Shigella flexneri 2a str. 301 |
| 2 | 72385 | 72645 | + | NZ_CP041249.1 | Raoultella electrica |
| 3 | 56830 | 57090 | - | NZ_CP032488.1 | Yersinia hibernica |
| 4 | 86498 | 86776 | - | NZ_CP065839.1 | Klebsiella quasipneumoniae |
| 5 | 7612 | 7866 | - | NZ_CP011600.1 | Phytobacter ursingii |
| 6 | 159484 | 159753 | - | NZ_CP026049.1 | Raoultella planticola |
| 7 | 73016 | 73285 | - | NZ_CP026048.1 | Raoultella planticola |
| 8 | 18295 | 18534 | - | NZ_CP017185.1 | Enterobacter roggenkampii |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP041249.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF13091.8 | 0.86 | 6 | 141 | same-strand | PLD-like domain |
++ More..