Result : A5IXN6
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 50S ribosomal protein L28 |
| NCBI Accession ID | CU179680.1 |
| Organism | Mycoplasma agalactiae (strain PG2) |
| Left | 110014 |
| Right | 110220 |
| Strand | + |
| Nucleotide Sequence | ATGGCAAGAAGAGATCAACTCAATGGTAAAGGCCCTCTTGTTGGAAACTTACGTTCTCACTCAATGATCGCTACAAAAAGAAAATTCAATGTAAACTTGCAAAAAATTACTATTGCAAATAGTAATGGCACCCCAACAACACTAAGAGTTAGCGCAAAAACAATTAAGACATTGAAGCGTAAGGGTATCCTTTCAGCACAAGCATAA |
| Sequence | MARRDQLNGKGPLVGNLRSHSMIATKRKFNVNLQKITIANSNGTPTTLRVSAKTIKTLKRKGILSAQA |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl00367. Profile Description: Ribosomal L28 family. This model describes bacterial and chloroplast forms of the 50S ribosomal protein L28, a polypeptide about 60 amino acids in length. Mitochondrial homologs differ substantially in architecture (e.g. SP|P36525 from Saccharomyces cerevisiae, which is 258 amino acids long) and are not included. [Protein synthesis, Ribosomal proteins: synthesis and modification] |
| Pubmed ID | 17511520 |
| Domain | CDD:412338 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | A5IXN6 |
| ORF Length (Amino Acid) | 68 |
++ More..
| Conservation Analysis |
No. of Species: 57
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 110014 | 110220 | + | NC_009497.1 | Mycoplasmopsis agalactiae PG2 |
| 2 | 116075 | 116281 | + | NZ_CP005933.1 | Mycoplasmopsis bovis CQ-W70 |
| 3 | 494568 | 494771 | - | NZ_LR215037.1 | Mycoplasmopsis maculosa |
| 4 | 956414 | 956614 | - | NC_014921.1 | Mycoplasmopsis fermentans M64 |
| 5 | 681100 | 681300 | + | NZ_LR215041.1 | Mycoplasmopsis columbina |
| 6 | 705423 | 705614 | + | NZ_LR214950.1 | Mycoplasmopsis gallinacea |
| 7 | 874842 | 875039 | + | NZ_LR214951.1 | Mycoplasma neurolyticum |
| 8 | 403914 | 404114 | - | NZ_LR215043.1 | Mycoplasmopsis columbinasalis |
| 9 | 756336 | 756527 | - | NZ_LR215039.1 | Mycoplasmopsis columboralis |
| 10 | 759071 | 759265 | + | NZ_CP041664.1 | Mycoplasma anserisalpingitidis |
| 11 | 691767 | 691961 | + | NZ_CP030141.1 | Mycoplasmopsis anatis |
| 12 | 69161 | 69361 | + | NZ_LR215042.1 | Mycoplasmopsis meleagridis |
| 13 | 158253 | 158444 | + | NZ_LR215024.1 | Mycoplasmopsis glycophila |
| 14 | 561067 | 561258 | + | NZ_LR215036.1 | Mycoplasmopsis citelli |
| 15 | 490361 | 490552 | - | NZ_LR215031.1 | Mycoplasmopsis gallopavonis |
| 16 | 519259 | 519456 | + | NC_006908.1 | Mycoplasma mobile 163K |
| 17 | 209181 | 209372 | + | NZ_LR214986.1 | Mycoplasmopsis cynos |
| 18 | 162619 | 162810 | + | NZ_LS991951.1 | Mycoplasmopsis edwardii |
| 19 | 728762 | 728953 | - | NZ_CP011368.1 | Mycoplasmopsis canis |
| 20 | 715127 | 715318 | + | NZ_LR214970.1 | Mycoplasmopsis bovigenitalium |
| 21 | 692839 | 693030 | + | NZ_LR214972.1 | Mycoplasmopsis bovirhinis |
| 22 | 186838 | 187029 | + | NZ_AP022325.1 | Mycoplasmopsis felis |
| 23 | 767983 | 768174 | - | NC_014014.1 | Mycoplasma crocodyli MP145 |
| 24 | 189142 | 189339 | - | NZ_CP030103.1 | Mycoplasma cloacale |
| 25 | 847620 | 847811 | - | NC_002771.1 | Mycoplasmopsis pulmonis UAB CTIP |
| 26 | 583418 | 583612 | + | NZ_AP018940.1 | Mycoplasmopsis californica |
| 27 | 136696 | 136890 | + | NZ_CP007154.1 | Mycoplasma bovoculi M165/69 |
| 28 | 718705 | 718896 | + | NZ_CP040825.1 | Mycoplasma nasistruthionis |
| 29 | 197649 | 197831 | + | NC_021283.1 | Mycoplasma hyopneumoniae 168-L |
| 30 | 946169 | 946369 | + | NZ_CP038013.1 | Spiroplasma gladiatoris |
| 31 | 1204777 | 1204968 | + | NZ_CP011391.1 | Faecalibaculum rodentium |
| 32 | 1123283 | 1123474 | + | NZ_AP019711.1 | Amedibacterium intestinale |
| 33 | 603134 | 603331 | - | NZ_CP030140.1 | Mycoplasma anseris |
| 34 | 2766 | 2963 | + | NZ_LR215047.1 | Mycoplasma arthritidis |
| 35 | 891228 | 891413 | - | NZ_AP024085.1 | Faecalibacillus intestinalis |
| 36 | 224132 | 224326 | - | NZ_CP024161.1 | Mycoplasma dispar |
| 37 | 731653 | 731838 | - | NZ_CP068170.1 | Erysipelatoclostridium ramosum |
| 38 | 643544 | 643741 | - | NZ_LR214938.2 | Mycoplasma salivarium |
| 39 | 533041 | 533235 | + | NC_000908.2 | Mycoplasma genitalium G37 |
| 40 | 1143978 | 1144163 | - | NZ_AP019309.1 | Intestinibaculum porci |
| 41 | 2801 | 2998 | + | NZ_LS991949.1 | Mycoplasma alkalescens |
| 42 | 381408 | 381602 | + | NZ_CP034841.1 | Mycoplasmopsis phocirhinis |
| 43 | 1168202 | 1168393 | + | NZ_CP013213.1 | Erysipelothrix larvae |
| 44 | 511901 | 512083 | - | NZ_CP007585.1 | Mycoplasma flocculare ATCC 27399 |
| 45 | 1846402 | 1846593 | + | NZ_CP060715.1 | Erysipelothrix inopinata |
| 46 | 20497 | 20733 | - | NC_013501.1 | Rhodothermus marinus DSM 4252 |
| 47 | 314024 | 314260 | - | NZ_CP007445.1 | Gilliamella apicola |
| 48 | 994147 | 994338 | - | NZ_CP034234.1 | Erysipelothrix piscisicarius |
| 49 | 1726336 | 1726527 | + | NZ_LR134439.1 | Erysipelothrix rhusiopathiae |
| 50 | 2095908 | 2096141 | - | NZ_CP022378.1 | Capnocytophaga cynodegmi |
| 51 | 631373 | 631606 | + | NZ_CP022387.1 | Capnocytophaga stomatis |
| 52 | 497974 | 498210 | - | NZ_CP022379.1 | Capnocytophaga sputigena |
| 53 | 2506848 | 2507084 | - | NZ_CP022022.1 | Capnocytophaga endodontalis |
| 54 | 2556803 | 2557039 | + | NC_013162.1 | Capnocytophaga ochracea DSM 7271 |
| 55 | 784768 | 785001 | - | NZ_CP022389.1 | Capnocytophaga canimorsus |
| 56 | 678615 | 678851 | - | NZ_LT906449.1 | Capnocytophaga haemolytica |
| 57 | 33204 | 33440 | - | NZ_CP031188.1 | Flavobacterium arcticum |
++ More..