Result : P62227
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 30S ribosomal protein S16 |
| NCBI Accession ID | BX842651.1 |
| Organism | Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) |
| Left | 287498 |
| Right | 287746 |
| Strand | - |
| Nucleotide Sequence | ATGGCAGTTGTAATTCGTTTGGCTCGTATGGGCGCTAAGCATGAACCTAAATACCGCGTTACTGTAGCGGATTCCCGTCGTTATGTGACTGGTAAATTCCTTGATATTCTTGGAACTTACATTCCATCTCCAAAAGGTAACGACAAAAAGATTGAGCTTGATCTGGCTAAAGTTGAAGAGTGGATCAAAAAAGGTGCTCAACCTACAGATCGCGTAAAACACGTGATCAAATTGGCTCAAGCTAAATAA |
| Sequence | MAVVIRLARMGAKHEPKYRVTVADSRRYVTGKFLDILGTYIPSPKGNDKKIELDLAKVEEWIKKGAQPTDRVKHVIKLAQAK |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl00368. Profile Description: Ribosomal protein S16. This model describes ribosomal S16 of bacteria and organelles. [Protein synthesis, Ribosomal proteins: synthesis and modification] |
| Pubmed ID | 14752164 |
| Domain | CDD:412339 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | P62227 |
| ORF Length (Amino Acid) | 82 |
++ More..
| Conservation Analysis |
No. of Species: 36
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2029202 | 2029450 | - | NC_005363.1 | Bdellovibrio bacteriovorus HD100 |
| 2 | 1584247 | 1584483 | + | NZ_CP021781.1 | Francisella adeliensis |
| 3 | 255824 | 256057 | - | NZ_CP022132.1 | Francisella halioticida |
| 4 | 563376 | 563609 | + | NZ_CP010427.1 | Allofrancisella guangzhouensis |
| 5 | 1575145 | 1575378 | - | NZ_CP022375.1 | Francisella opportunistica |
| 6 | 1935220 | 1935453 | - | NZ_CP016796.1 | Francisella uliginis |
| 7 | 1673975 | 1674208 | - | NC_023029.1 | Francisella orientalis LADL--07-285A |
| 8 | 1683334 | 1683567 | - | NC_017449.1 | Francisella hispaniensis |
| 9 | 657445 | 657678 | + | NC_015696.1 | Francisella salina |
| 10 | 14679 | 14912 | + | NZ_CP043552.1 | Francisella marina |
| 11 | 299308 | 299541 | + | NZ_CP038241.1 | Allofrancisella inopinata |
| 12 | 800243 | 800512 | - | NZ_LR699114.1 | Aquicella lusitana |
| 13 | 1992254 | 1992496 | - | NZ_AP021888.1 | Thiosulfativibrio zosterae |
| 14 | 1368177 | 1368410 | - | NZ_CP038017.1 | Allofrancisella frigidaquae |
| 15 | 1470522 | 1470764 | + | NZ_CP007514.1 | Rubrobacter radiotolerans |
| 16 | 1748887 | 1749126 | - | NZ_AP020335.1 | Hydrogenovibrio marinus |
| 17 | 2009161 | 2009406 | + | NC_016627.1 | Acetivibrio clariflavus DSM 19732 |
| 18 | 1879313 | 1879555 | - | NZ_CP025197.1 | Acetivibrio saccincola |
| 19 | 1140678 | 1140923 | + | NZ_LR134379.1 | Slackia heliotrinireducens |
| 20 | 1646403 | 1646648 | + | NC_013204.1 | Eggerthella lenta DSM 2243 |
| 21 | 2546670 | 2546915 | - | NZ_CP061336.1 | Ruminiclostridium herbifermentans |
| 22 | 1713057 | 1713302 | + | NZ_CP016502.1 | Acetivibrio thermocellus DSM 2360 |
| 23 | 2527247 | 2527495 | - | NZ_CP028842.1 | Clostridium botulinum |
| 24 | 2905812 | 2906054 | - | NZ_CP015756.1 | Clostridium estertheticum subsp. estertheticum |
| 25 | 822000 | 822245 | + | NC_011898.1 | Ruminiclostridium cellulolyticum H10 |
| 26 | 356242 | 356481 | - | NC_013894.1 | Thermocrinis albus DSM 14484 |
| 27 | 2789733 | 2789981 | - | NZ_CP011663.1 | Clostridium sporogenes |
| 28 | 2747011 | 2747268 | - | NC_014972.1 | Desulfobulbus propionicus DSM 2032 |
| 29 | 4402178 | 4402444 | - | NC_009483.1 | Geobacter uraniireducens Rf4 |
| 30 | 822070 | 822324 | - | NZ_CP009761.1 | Parvimonas micra |
| 31 | 410577 | 410798 | - | NZ_AP013035.1 | Thermosulfidibacter takaii ABI70S6 |
| 32 | 1403969 | 1404226 | - | NC_008593.1 | Clostridium novyi NT |
| 33 | 459992 | 460234 | + | NC_014833.1 | Ruminococcus albus 7 = DSM 20455 |
| 34 | 3088140 | 3088391 | - | NZ_CP054140.1 | Desulfobulbus oligotrophicus |
| 35 | 851024 | 851266 | + | NZ_CP030777.1 | Faecalibacterium prausnitzii |
| 36 | 1918908 | 1919189 | + | NZ_CP036259.1 | Sporomusa termitida |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP007514.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01245.22 | 0.75 | 27 | 1639 | same-strand | Ribosomal protein L19 |
| 2 | PF01746.23 | 0.92 | 33 | 828 | same-strand | tRNA (Guanine-1)-methyltransferase |
| 3 | PF01782.20 | 0.92 | 33 | 244 | same-strand | RimM N-terminal domain |
| 4 | PF13083.8 | 0.61 | 22 | 27.5 | same-strand | KH domain |
| 5 | PF05239.18 | 0.81 | 29 | 263 | same-strand | PRC-barrel domain |
++ More..