| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Probable spore germination protein GerPF |
| NCBI Accession ID | |
| Organism | Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | |
| Sequence | MPSVVGNLVVQNSNGSFNLGDFYNVSPKENTKAYNGSGASNVGFVVNTFNGVSATNTFDSDVADQDQIGTA |
| Source of smORF | Swiss-Prot |
| Function | Required for the formation of functionally normal spores. Could be involved in the establishment of normal spore coat structure and/or permeability, which allows the access of germinants to their receptor. |
| Pubmed ID | 12721630 |
| Domain | CDD:371190 |
| Functional Category | Others |
| Uniprot ID | P62185 |
| ORF Length (Amino Acid) | 71 |
| Conservation Analysis |
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1119714 | 1119929 | - | NC_007530.2 | Bacillus anthracis str. 'Ames Ancestor' |
| 2 | 2175542 | 2175757 | - | NC_007530.2 | Bacillus anthracis str. 'Ames Ancestor' |
| 3 | 4578872 | 4579087 | - | NC_007530.2 | Bacillus anthracis str. 'Ames Ancestor' |
| 4 | 1102331 | 1102546 | - | NZ_CP064875.1 | Bacillus toyonensis |
| 5 | 2208231 | 2208446 | - | NZ_CP064875.1 | Bacillus toyonensis |
| 6 | 4607534 | 4607749 | - | NZ_CP064875.1 | Bacillus toyonensis |
| 7 | 1166711 | 1166926 | - | NC_011725.1 | Bacillus cereus B4264 |
| 8 | 2204024 | 2204239 | - | NC_011725.1 | Bacillus cereus B4264 |
| 9 | 4754374 | 4754589 | - | NC_011725.1 | Bacillus cereus B4264 |
| 10 | 3963104 | 3963319 | + | NZ_CP040336.1 | Bacillus luti |
| 11 | 2918772 | 2918987 | + | NZ_CP040336.1 | Bacillus luti |
| 12 | 577502 | 577717 | + | NZ_CP040336.1 | Bacillus luti |
| 13 | 1134786 | 1135001 | - | NZ_CP032365.1 | Bacillus wiedmannii |
| 14 | 2238382 | 2238597 | - | NZ_CP032365.1 | Bacillus wiedmannii |
| 15 | 4791418 | 4791633 | - | NZ_CP032365.1 | Bacillus wiedmannii |
| 16 | 974967 | 975182 | - | NZ_CP024109.1 | Bacillus cytotoxicus |
| 17 | 1819235 | 1819450 | - | NZ_CP024109.1 | Bacillus cytotoxicus |
| 18 | 1956677 | 1956892 | - | NZ_CP024109.1 | Bacillus cytotoxicus |
| 19 | 5606428 | 5606670 | + | NZ_CP011058.1 | Paenibacillus beijingensis |
| Neighborhood Conservation Analysis |
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF09335.13 | 0.71 | 5 | 8411 | opposite-strand | SNARE associated Golgi protein |
| 2 | PF10502.11 | 0.71 | 5 | 7736 | opposite-strand | Signal peptidase, peptidase S26 |
| 3 | PF12705.9 | 0.71 | 5 | 4104 | opposite-strand | PD-(D/E)XK nuclease superfamily |
| 4 | PF13361.8 | 0.71 | 5 | 2128.5 | opposite-strand | UvrD-like helicase C-terminal domain |
| 5 | PF00580.23 | 0.71 | 5 | 382 | opposite-strand | UvrD/REP helicase N-terminal domain |
| 6 | PF13245.8 | 0.71 | 5 | 382 | opposite-strand | AAA domain |
| 7 | PF10970.10 | 1.0 | 7 | 43 | same-strand | Spore germination protein GerPE |
| 8 | PF10737.11 | 1.0 | 7 | 646 | same-strand | Spore germination protein GerPC |
| 9 | PF10803.10 | 1.0 | 7 | 1328 | same-strand | Spore germination GerPB |
| 10 | PF10676.11 | 0.86 | 6 | 1550.0 | same-strand | Spore germination protein gerPA/gerPF |
| 11 | PF13616.8 | 0.71 | 5 | 2099 | opposite-strand | PPIC-type PPIASE domain |
| 12 | PF00639.23 | 0.71 | 5 | 2099 | opposite-strand | PPIC-type PPIASE domain |
| 13 | PF13145.8 | 0.71 | 5 | 2099 | opposite-strand | PPIC-type PPIASE domain |
| 14 | PF08863.12 | 0.71 | 5 | 209 | opposite-strand | YolD-like protein |
| 15 | PF01679.19 | 0.71 | 5 | 2674 | opposite-strand | Proteolipid membrane potential modulator |
| 16 | PF02664.17 | 0.71 | 5 | 3684 | same-strand | S-Ribosylhomocysteinase (LuxS) |
| 17 | PF01809.20 | 0.86 | 6 | 3319.5 | opposite-strand | Putative membrane protein insertion efficiency factor |
| 18 | PF00484.21 | 0.71 | 5 | 2759 | same-strand | Carbonic anhydrase |
| 19 | PF01654.19 | 0.71 | 5 | 1185 | opposite-strand | Cytochrome bd terminal oxidase subunit I |
| 20 | PF02322.17 | 0.71 | 5 | 167 | opposite-strand | Cytochrome bd terminal oxidase subunit II |
| 21 | PF02698.19 | 0.71 | 5 | 1219 | opposite-strand | DUF218 domain |
| 22 | PF02588.17 | 0.71 | 5 | 2442 | opposite-strand | Uncharacterised 5xTM membrane BCR, YitT family COG1284 |
| 23 | PF10035.11 | 0.71 | 5 | 2442 | opposite-strand | Uncharacterized protein conserved in bacteria (DUF2179) |
| 24 | PF14042.8 | 0.71 | 5 | 3734 | same-strand | Domain of unknown function (DUF4247) |
| 25 | PF01183.22 | 0.71 | 5 | 3057 | opposite-strand | Glycosyl hydrolases family 25 |