Result : P62164
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Probable spore germination protein GerPA |
| NCBI Accession ID | AE016879.1 |
| Organism | Bacillus anthracis |
| Left | 1121477 |
| Right | 1121698 |
| Strand | - |
| Nucleotide Sequence | ATGCCAGCTATGGTCGGACATATTCGTATCGTCAATATTGGATCAAGTGGTATTTTTCATATTGGAGATGTATTTGCGATTAGGCCTATTAGTTATTCACGCGCTTTCGCGGGGGCCGGCTCTTTTAACGTTGGAGATAACGTTTCTGTCTACAATTATCAAAGTGCAACGACTGTTAATGATTCAGATGTCGTCGATCAAGCGATAATTGGTTCAACTTAA |
| Sequence | MPAMVGHIRIVNIGSSGIFHIGDVFAIRPISYSRAFAGAGSFNVGDNVSVYNYQSATTVNDSDVVDQAIIGST |
| Source of smORF | Swiss-Prot |
| Function | Required for the formation of functionally normal spores. Could be involved in the establishment of normal spore coat structure and/or permeability, which allows the access of germinants to their receptor (By similarity). {ECO:0000250}. |
| Pubmed ID | 12721629 18952800 |
| Domain | CDD:371190 |
| Functional Category | Others |
| Uniprot ID | P62164 |
| ORF Length (Amino Acid) | 73 |
++ More..
| Conservation Analysis |
No. of Species: 42
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3961333 | 3961554 | + | NZ_CP040336.1 | Bacillus luti |
| 2 | 1121477 | 1121698 | - | NC_007530.2 | Bacillus anthracis str. 'Ames Ancestor' |
| 3 | 1168475 | 1168696 | - | NC_011725.1 | Bacillus cereus B4264 |
| 4 | 1104096 | 1104317 | - | NZ_CP064875.1 | Bacillus toyonensis |
| 5 | 1136551 | 1136772 | - | NZ_CP032365.1 | Bacillus wiedmannii |
| 6 | 976734 | 976955 | - | NZ_CP024109.1 | Bacillus cytotoxicus |
| 7 | 1897304 | 1897525 | + | NZ_CP068053.1 | Peribacillus psychrosaccharolyticus |
| 8 | 2584646 | 2584867 | + | NZ_CP014342.1 | Geobacillus subterraneus |
| 9 | 1016647 | 1016868 | - | NZ_CP015438.1 | Anoxybacillus amylolyticus |
| 10 | 208358 | 208579 | - | NZ_CP064060.1 | Anoxybacillus caldiproteolyticus |
| 11 | 2865137 | 2865358 | + | NZ_CP065425.1 | Heyndrickxia vini |
| 12 | 710714 | 710935 | - | NC_006510.1 | Geobacillus kaustophilus HTA426 |
| 13 | 3377585 | 3377806 | - | NZ_CP061470.1 | Geobacillus zalihae |
| 14 | 1574837 | 1575058 | + | NZ_CP061472.1 | Geobacillus thermoleovorans |
| 15 | 3173432 | 3173653 | + | NZ_CP070511.1 | Parageobacillus toebii |
| 16 | 1355625 | 1355846 | + | NZ_CP017704.1 | Peribacillus simplex NBRC 15720 = DSM 1321 |
| 17 | 3291293 | 3291514 | + | NZ_CP018058.1 | Geobacillus thermocatenulatus |
| 18 | 3234502 | 3234723 | - | NZ_CP009709.1 | Weizmannia coagulans DSM 1 = ATCC 7050 |
| 19 | 909557 | 909778 | - | NZ_CP012024.1 | Bacillus smithii |
| 20 | 1402270 | 1402491 | - | NZ_CP016622.1 | Parageobacillus thermoglucosidasius |
| 21 | 3815183 | 3815404 | - | NZ_CP030926.1 | Peribacillus butanolivorans |
| 22 | 548357 | 548578 | - | NZ_CP012152.1 | Anoxybacillus gonensis |
| 23 | 1082899 | 1083120 | - | NZ_CP048852.1 | Bacillus tequilensis |
| 24 | 2988420 | 2988641 | + | NZ_LS483476.1 | Lederbergia lentus |
| 25 | 1129118 | 1129339 | - | NZ_CP013984.1 | Bacillus inaquosorum |
| 26 | 1319011 | 1319232 | - | NZ_CP033052.1 | Bacillus vallismortis |
| 27 | 839652 | 839873 | + | NZ_CP029364.1 | Bacillus halotolerans |
| 28 | 1150206 | 1150427 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 29 | 1305223 | 1305444 | - | NC_022524.1 | Bacillus infantis NRRL B-14911 |
| 30 | 1154530 | 1154751 | - | NZ_CP051464.1 | Bacillus mojavensis |
| 31 | 1123799 | 1124020 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 32 | 947386 | 947604 | - | NZ_CP029797.1 | Paraliobacillus zengyii |
| 33 | 889700 | 889921 | - | NZ_CP018866.1 | Sutcliffiella cohnii |
| 34 | 2878668 | 2878889 | + | NZ_CP011937.1 | Bacillus velezensis |
| 35 | 1067978 | 1068199 | - | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 36 | 625289 | 625510 | - | NZ_CP024035.1 | Priestia aryabhattai |
| 37 | 149422 | 149643 | + | NZ_CP041305.1 | Cytobacillus ciccensis |
| 38 | 472000 | 472221 | + | NZ_CP022983.1 | Cytobacillus kochii |
| 39 | 1684901 | 1685122 | - | NZ_CP042593.1 | Bacillus dafuensis |
| 40 | 3192822 | 3193043 | + | NZ_CP016020.1 | Bacillus weihaiensis |
| 41 | 1230171 | 1230392 | - | NZ_LT603683.1 | Bacillus glycinifermentans |
| 42 | 3186588 | 3186809 | - | NZ_CP063356.1 | Anaerobacillus isosaccharinicus |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP040336.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF07457.13 | 0.67 | 28 | 2922.5 | opposite-strand | Protein of unknown function (DUF1516) |
| 2 | PF01557.20 | 0.74 | 31 | 1785 | opposite-strand | Fumarylacetoacetate (FAA) hydrolase family |
| 3 | PF10803.10 | 0.95 | 40 | 15.0 | same-strand | Spore germination GerPB |
| 4 | PF10737.11 | 0.98 | 41 | 290 | same-strand | Spore germination protein GerPC |
| 5 | PF10970.10 | 0.88 | 37 | 1099 | same-strand | Spore germination protein GerPE |
| 6 | PF10676.11 | 0.98 | 41 | 1495.0 | same-strand | Spore germination protein gerPA/gerPF |
++ More..