Result : P61624
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Excisionase from transposon Tn1545 |
| NCBI Accession ID | X61025.1 |
| Organism | Streptococcus pneumoniae |
| Left | 230 |
| Right | 433 |
| Strand | + |
| Nucleotide Sequence | ATGAAGCAGACTGACATTCCTATTTGGGAACGTTATACCCTAACCATTGAAGAAGCGTCAAAATATTTTCGTATTGGCGAAAACAAGCTACGACGCTTGGCAGAGGAAAATAAAAATGCAAATTGGCTGATTATGAATGGCAATCGTATTCAGATTAAACGAAAACAATTTGAAAAAATTATAGATACATTGGACGCAATCTAG |
| Sequence | MKQTDIPIWERYTLTIEEASKYFRIGENKLRRLAEENKNANWLIMNGNRIQIKRKQFEKIIDTLDAI |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl02600. Profile Description: Helix-Turn-Helix DNA binding domain of transcription regulators from the MerR superfamily. This domain is a DNA-binding helix-turn-helix domain. |
| Pubmed ID | 2551683 |
| Domain | CDD:413393 |
| Functional Category | Others |
| Uniprot ID | P61624 |
| ORF Length (Amino Acid) | 67 |
++ More..
| Conservation Analysis |
No. of Species: 36
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1491642 | 1491845 | + | NZ_CP014159.1 | Aerococcus christensenii |
| 2 | 80305 | 80508 | - | NZ_LR134524.1 | Peptoniphilus harei |
| 3 | 1485491 | 1485694 | + | NZ_CP046314.1 | Gemella morbillorum |
| 4 | 554630 | 554833 | + | NC_013895.2 | Mageeibacillus indolicus UPII9-5 |
| 5 | 1366852 | 1367055 | - | NZ_LR215048.1 | Acholeplasma axanthum |
| 6 | 241552 | 241755 | - | NZ_CP012805.1 | Streptococcus anginosus |
| 7 | 687776 | 687979 | + | NZ_LR594050.1 | Streptococcus porcinus |
| 8 | 894068 | 894271 | + | NZ_CP032621.1 | Streptococcus gwangjuense |
| 9 | 1145384 | 1145587 | + | NZ_LS483383.1 | Streptococcus cristatus ATCC 51100 |
| 10 | 889468 | 889671 | - | NC_012924.1 | Streptococcus suis SC84 |
| 11 | 1689994 | 1690197 | - | NZ_AP022321.1 | Veillonella nakazawae |
| 12 | 2085016 | 2085219 | - | NZ_CP039457.1 | Streptococcus pasteurianus |
| 13 | 1581145 | 1581351 | - | NZ_CP039457.1 | Streptococcus pasteurianus |
| 14 | 1074297 | 1074500 | - | NZ_CP039457.1 | Streptococcus pasteurianus |
| 15 | 596341 | 596544 | + | NZ_LR134341.1 | Streptococcus pseudoporcinus |
| 16 | 246013 | 246216 | + | NC_015875.1 | Streptococcus pseudopneumoniae IS7493 |
| 17 | 356162 | 356365 | - | NZ_CP054015.1 | Streptococcus gallolyticus |
| 18 | 2132011 | 2132214 | - | NZ_CP023434.1 | Suicoccus acidiformans |
| 19 | 2197115 | 2197318 | - | NC_014925.1 | Staphylococcus pseudintermedius HKU10-03 |
| 20 | 1710521 | 1710724 | - | NZ_LT635772.1 | Anaerococcus mediterraneensis |
| 21 | 1248550 | 1248753 | - | NC_016630.1 | Filifactor alocis ATCC 35896 |
| 22 | 1253715 | 1253918 | + | NZ_CP006712.1 | Bifidobacterium breve JCM 7017 |
| 23 | 211207 | 211410 | - | NZ_CP040058.1 | Anaerostipes rhamnosivorans |
| 24 | 1914121 | 1914324 | + | NZ_CP019870.1 | Clostridioides difficile |
| 25 | 1603012 | 1603215 | + | NZ_CP019870.1 | Clostridioides difficile |
| 26 | 2728743 | 2728949 | + | NZ_CP068170.1 | Erysipelatoclostridium ramosum |
| 27 | 1037076 | 1037279 | + | NZ_CP068170.1 | Erysipelatoclostridium ramosum |
| 28 | 3355368 | 3355568 | - | NZ_CP068170.1 | Erysipelatoclostridium ramosum |
| 29 | 2377036 | 2377242 | - | NZ_AP024085.1 | Faecalibacillus intestinalis |
| 30 | 2074677 | 2074880 | - | NC_015385.1 | Treponema succinifaciens DSM 2489 |
| 31 | 1428984 | 1429187 | + | NZ_CP030280.1 | Blautia argi |
| 32 | 2662052 | 2662255 | + | NZ_CP030280.1 | Blautia argi |
| 33 | 376834 | 377037 | + | NZ_CP070062.1 | Coprococcus comes |
| 34 | 3537703 | 3537906 | - | NZ_CP027002.1 | [Ruminococcus] gnavus ATCC 29149 |
| 35 | 648978 | 649181 | + | NZ_CP027002.1 | [Ruminococcus] gnavus ATCC 29149 |
| 36 | 745733 | 745936 | - | NZ_CP027002.1 | [Ruminococcus] gnavus ATCC 29149 |
| 37 | 116704 | 116907 | + | NZ_LR027880.1 | Roseburia intestinalis L1-82 |
| 38 | 1457419 | 1457622 | - | NZ_CP029256.1 | Christensenella minuta |
| 39 | 5609336 | 5609539 | + | NZ_CP039126.1 | Blautia producta |
| 40 | 5780813 | 5781016 | - | NZ_CP022464.2 | Enterocloster bolteae |
| 41 | 4191494 | 4191697 | - | NZ_CP029487.1 | Eubacterium maltosivorans |
| 42 | 2214626 | 2214826 | + | NZ_AP019711.1 | Amedibacterium intestinale |
| 43 | 811225 | 811389 | + | NZ_CP036170.1 | [Clostridium] scindens ATCC 35704 |
| 44 | 1282520 | 1282720 | - | NC_014833.1 | Ruminococcus albus 7 = DSM 20455 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP014159.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01381.24 | 0.75 | 27 | 1615 | opposite-strand | Helix-turn-helix |
| 2 | PF13560.8 | 0.69 | 25 | 1615.0 | opposite-strand | Helix-turn-helix domain |
| 3 | PF12844.9 | 0.72 | 26 | 1615 | opposite-strand | Helix-turn-helix domain |
| 4 | PF08281.14 | 0.69 | 25 | 688 | same-strand | Sigma-70, region 4 |
| 5 | PF04545.18 | 0.72 | 26 | 688.0 | same-strand | Sigma-70, region 4 |
| 6 | PF12645.9 | 0.81 | 29 | 461.0 | same-strand | Helix-turn-helix domain |
| 7 | PF00589.24 | 0.94 | 34 | 81.5 | same-strand | Phage integrase family |
| 8 | PF02920.17 | 1.0 | 36 | 80 | same-strand | DNA binding domain of tn916 integrase |
| 9 | PF13102.8 | 0.75 | 27 | 82.0 | same-strand | Phage integrase SAM-like domain |
++ More..