Protein Information |
Information Type | Description |
---|---|
Protein name | Exodeoxyribonuclease 7 small subunit (EC 3.1.11.6) (Exodeoxyribonuclease VII small subunit) (Exonuclease VII small subunit) |
NCBI Accession ID | CP000702.1 |
Organism | Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) |
Left | 1084650 |
Right | 1084877 |
Strand | + |
Nucleotide Sequence | GTGAATTTCGAGGAAATGATGAAAGAACTGGAGGAAATCGTAAACAGACTGGAAAACGAGGATCTTCCACTCGAAGAATCCATCAAACTCTTTGAACGCGGAGTGGAGCTCTACAGAAAGTGCAAAGAGATTCTTCAGCAAAACAGGCTGAAGATCATAGACGTGATGAAAGAGCTGGAAGGTGAGATAGATGCTTCTGGACGAGATCAAGAGAATGAGCTACGATGA |
Sequence | MNFEEMMKELEEIVNRLENEDLPLEESIKLFERGVELYRKCKEILQQNRLKIIDVMKELEGEIDASGRDQENELR |
Source of smORF | Swiss-Prot |
Function | Bidirectionally degrades single-stranded DNA into large acid-insoluble oligonucleotides, which are then degraded further into small acid-soluble oligonucleotides. {ECO:0000255|HAMAP-Rule:MF_00337}. |
Pubmed ID | |
Domain | CDD:412547 |
Functional Category | Others |
Uniprot ID | A5ILK1 |
ORF Length (Amino Acid) | 75 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 1084650 | 1084877 | + | NC_009486.1 | Thermotoga petrophila RKU-1 |
2 | 1069332 | 1069559 | - | NC_023151.1 | Thermotoga maritima MSB8 |
3 | 1084808 | 1085035 | - | NC_013642.1 | Thermotoga naphthophila RKU-10 |
4 | 951060 | 951284 | + | NC_011978.1 | Thermotoga neapolitana DSM 4359 |
5 | 1778222 | 1778440 | - | NZ_CP030840.1 | Acidisarcina polymorpha |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF03780.15 | 0.8 | 4 | 2943.0 | same-strand | Asp23 family, cell envelope-related function |
2 | PF01029.20 | 0.8 | 4 | 3647.0 | same-strand | NusB family |
3 | PF01268.21 | 0.8 | 4 | 2007.0 | same-strand | Formate--tetrahydrofolate ligase |
4 | PF02882.21 | 0.8 | 4 | 1178.0 | same-strand | Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain |
5 | PF00763.25 | 0.8 | 4 | 1178.0 | same-strand | Tetrahydrofolate dehydrogenase/cyclohydrolase, catalytic domain |
6 | PF02601.17 | 0.6 | 3 | -3 | same-strand | Exonuclease VII, large subunit |
7 | PF13742.8 | 0.8 | 4 | -3.0 | same-strand | OB-fold nucleic acid binding domain |
8 | PF01336.27 | 1.0 | 5 | -3 | same-strand | OB-fold nucleic acid binding domain |
9 | PF13292.8 | 0.8 | 4 | -37.0 | same-strand | 1-deoxy-D-xylulose-5-phosphate synthase |
10 | PF02779.26 | 0.8 | 4 | -37.0 | same-strand | Transketolase, pyrimidine binding domain |
11 | PF02780.22 | 0.8 | 4 | -37.0 | same-strand | Transketolase, C-terminal domain |
12 | PF13684.8 | 0.8 | 4 | 2132.0 | same-strand | Dihydroxyacetone kinase family |
13 | PF02734.19 | 0.8 | 4 | 2132.0 | same-strand | DAK2 domain |
14 | PF07719.19 | 0.8 | 4 | 3715.0 | same-strand | Tetratricopeptide repeat |
15 | PF13432.8 | 0.8 | 4 | 3715.0 | same-strand | Tetratricopeptide repeat |
16 | PF13181.8 | 0.8 | 4 | 3715.0 | same-strand | Tetratricopeptide repeat |
17 | PF14559.8 | 0.8 | 4 | 3715.0 | same-strand | Tetratricopeptide repeat |
18 | PF13424.8 | 0.6 | 3 | 3715 | same-strand | Tetratricopeptide repeat |
19 | PF13428.8 | 0.8 | 4 | 3715.0 | same-strand | Tetratricopeptide repeat |
20 | PF00515.30 | 0.8 | 4 | 3715.0 | same-strand | Tetratricopeptide repeat |
21 | PF13414.8 | 0.8 | 4 | 3715.0 | same-strand | TPR repeat |
22 | PF13176.8 | 0.6 | 3 | 3715 | same-strand | Tetratricopeptide repeat |
23 | PF12895.9 | 0.6 | 3 | 3715 | same-strand | Anaphase-promoting complex, cyclosome, subunit 3 |
24 | PF17004.7 | 0.6 | 3 | 3715 | same-strand | Putative TPR-like repeat |
25 | PF10143.11 | 0.8 | 4 | 5334.0 | same-strand | 2,3-bisphosphoglycerate-independent phosphoglycerate mutase |
26 | PF01676.20 | 0.8 | 4 | 5334.0 | same-strand | Metalloenzyme superfamily |