Result : P61465
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Putative membrane protein insertion efficiency factor |
| NCBI Accession ID | BX927157.1 |
| Organism | Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) |
| Left | 138345 |
| Right | 138644 |
| Strand | - |
| Nucleotide Sequence | GTGTGCGCACCAACAAGTGATGATCCTTTCGACATCCCAGAACCGAAAAGTATTCCGGCGAAGACGGCAGCTTCTGCTGTTCGCTTCTACCAAAAGTATCTTTCGGGTCTTAAGATGGGTTCCACCTGTCGTTTTGATCCAGTTTGCAGCACCTATGCATTGAAAGCCGTCTCAGTTCATGGGGCTTTTAAGGGAACTATTCTCTCCGCTGCAAGGTTGTCCAAATGTGGGCCCTGGCATCCGGGTGGATTCGACCCGGTGCCGAACCATGGATTTTGGTCCACCGAAACGGTGACATAG |
| Sequence | MCAPTSDDPFDIPEPKSIPAKTAASAVRFYQKYLSGLKMGSTCRFDPVCSTYALKAVSVHGAFKGTILSAARLSKCGPWHPGGFDPVPNHGFWSTETVT |
| Source of smORF | Swiss-Prot |
| Function | Could be involved in insertion of integral membrane proteins into the membrane. {ECO:0000255|HAMAP-Rule:MF_00386}. |
| Pubmed ID | 12743753 12948626 |
| Domain | CDD:412414 |
| Functional Category | Others |
| Uniprot ID | P61465 |
| ORF Length (Amino Acid) | 99 |
++ More..
| Conservation Analysis |
No. of Species: 22
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3535814 | 3536113 | - | NZ_AP017369.1 | Corynebacterium suranareeae |
| 2 | 3045683 | 3045982 | - | NZ_CP015622.1 | Corynebacterium crudilactis |
| 3 | 2970439 | 2970738 | - | NZ_CP009220.1 | Corynebacterium deserti GIMN1.010 |
| 4 | 3145349 | 3145648 | - | NC_004369.1 | Corynebacterium efficiens YS-314 |
| 5 | 2837806 | 2838111 | - | NC_020506.1 | Corynebacterium callunae DSM 20147 |
| 6 | 2719702 | 2719983 | - | NZ_CP011545.1 | Corynebacterium testudinoris |
| 7 | 2352281 | 2352535 | - | NZ_CP011312.1 | Corynebacterium kutscheri |
| 8 | 2807179 | 2807454 | - | NZ_CP009251.1 | Corynebacterium stationis |
| 9 | 2778199 | 2778468 | - | NZ_CP009249.1 | Corynebacterium phocae |
| 10 | 2681539 | 2681808 | + | NZ_LT906473.1 | Corynebacterium cystitidis |
| 11 | 80297 | 80545 | - | NZ_LT906467.1 | Corynebacterium imitans |
| 12 | 2335444 | 2335710 | - | NC_017301.2 | Corynebacterium pseudotuberculosis C231 |
| 13 | 2417796 | 2418071 | - | NZ_CP011546.1 | Corynebacterium uterequi |
| 14 | 2509957 | 2510232 | - | NZ_CP026947.1 | Corynebacterium yudongzhengii |
| 15 | 2278508 | 2278795 | - | NZ_CP009215.1 | Corynebacterium ureicelerivorans |
| 16 | 2599296 | 2599592 | - | NC_015673.1 | Corynebacterium resistens DSM 45100 |
| 17 | 2206588 | 2206836 | - | NZ_CP046883.1 | Corynebacterium anserum |
| 18 | 265732 | 266049 | + | NZ_LS483459.1 | Corynebacterium jeikeium |
| 19 | 2923999 | 2924301 | - | NZ_CP009245.1 | Corynebacterium aquilae DSM 44791 |
| 20 | 2749581 | 2749874 | - | NC_021663.1 | Corynebacterium terpenotabidum Y-11 |
| 21 | 1259299 | 1259541 | - | NZ_CP068161.1 | Corynebacterium propinquum |
| 22 | 2180832 | 2181119 | + | NZ_CP042429.1 | Corynebacterium nuruki S6-4 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_AP017369.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02195.20 | 0.91 | 20 | 2929.5 | same-strand | ParB-like nuclease domain |
| 2 | PF17762.3 | 0.95 | 21 | 2955 | same-strand | HTH domain found in ParB protein |
| 3 | PF13614.8 | 1.0 | 22 | 1971.0 | same-strand | AAA domain |
| 4 | PF01656.25 | 1.0 | 22 | 1971.0 | same-strand | CobQ/CobB/MinD/ParA nucleotide binding domain |
| 5 | PF02527.17 | 1.0 | 22 | 1190.0 | same-strand | rRNA small subunit methyltransferase G |
| 6 | PF02096.22 | 1.0 | 22 | 55.0 | same-strand | 60Kd inner membrane protein |
| 7 | PF00825.20 | 0.64 | 14 | -15.5 | same-strand | Ribonuclease P |
| 8 | PF00468.19 | 0.86 | 19 | 414 | same-strand | Ribosomal protein L34 |
++ More..