Result : P60743
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 50S ribosomal protein L24 |
| NCBI Accession ID | AP006628.2 |
| Organism | Onion yellows phytoplasma (strain OY-M) |
| Left | 248611 |
| Right | 248850 |
| Strand | + |
| Nucleotide Sequence | TTGCCAAAACTCAAAAAATTATTGTTGAAGGTGTCAACATCAAAACCAAACACCAACCCCCCTTCACAAAACGAAGAAAAGGGCACCATCGTTAAACAAGAAGCTCCCATTCATGTTTCTAATGTAGCTTTAGTTTGCCCCCAAACACAAACTCCCACTAAAGTAGGAATTCGCATACAATCAGGTAAAAAAGTTCGTTATGCTAAAAAATCAAATCAAACATTAGACGAAAAAAATTAA |
| Sequence | MPKLKKLLLKVSTSKPNTNPPSQNEEKGTIVKQEAPIHVSNVALVCPQTQTPTKVGIRIQSGKKVRYAKKSNQTLDEKN |
| Source of smORF | Swiss-Prot |
| Function | One of two assembly initiator proteins, it binds directly to the 5'-end of the 23S rRNA, where it nucleates assembly of the 50S subunit. {ECO:0000250}.; One of the proteins that surrounds the polypeptide exit tunnel on the outside of the subunit. {ECO:0000250}. |
| Pubmed ID | 14661021 |
| Domain | CDD:407270 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | P60743 |
| ORF Length (Amino Acid) | 79 |
++ More..
| Conservation Analysis |
No. of Species: 4
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 194185 | 194397 | - | NZ_CP029971.1 | Lentilactobacillus kefiri |
| 2 | 1792616 | 1792831 | + | NZ_CP021434.1 | Tumebacillus avium |
| 3 | 4365209 | 4365424 | - | NZ_CP022657.1 | Tumebacillus algifaecis |
| 4 | 1008932 | 1009177 | - | NZ_LR215050.1 | Acholeplasma hippikon |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP029971.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00861.24 | 1.0 | 4 | 1817.5 | same-strand | Ribosomal L18 of archaea, bacteria, mitoch. and chloroplast |
| 2 | PF00347.25 | 1.0 | 4 | 1249.5 | same-strand | Ribosomal protein L6 |
| 3 | PF00410.21 | 1.0 | 4 | 821.0 | same-strand | Ribosomal protein S8 |
| 4 | PF00253.23 | 0.75 | 3 | 587 | same-strand | Ribosomal protein S14p/S29e |
| 5 | PF00673.23 | 1.0 | 4 | 27.5 | same-strand | ribosomal L5P family C-terminus |
| 6 | PF00281.21 | 1.0 | 4 | 27.5 | same-strand | Ribosomal protein L5 |
| 7 | PF00238.21 | 1.0 | 4 | 149.5 | same-strand | Ribosomal protein L14p/L23e |
| 8 | PF00366.22 | 1.0 | 4 | 562.5 | same-strand | Ribosomal protein S17 |
| 9 | PF00831.25 | 1.0 | 4 | 853.5 | same-strand | Ribosomal L29 protein |
| 10 | PF00252.20 | 1.0 | 4 | 1039.0 | same-strand | Ribosomal protein L16p/L10e |
| 11 | PF00189.22 | 1.0 | 4 | 1476.5 | same-strand | Ribosomal protein S3, C-terminal domain |
| 12 | PF07650.19 | 1.0 | 4 | 1476.5 | same-strand | KH domain |
++ More..