Protein Information |
Information Type | Description |
---|---|
Protein name | DNA-directed RNA polymerase subunit omega (RNAP omega subunit) (EC 2.7.7.6) (RNA polymerase omega subunit) (Transcriptase subunit omega) |
NCBI Accession ID | AE001439.1 |
Organism | Helicobacter pylori (strain J99 / ATCC 700824) (Campylobacter pylori J99) |
Left | 792571 |
Right | 792795 |
Strand | - |
Nucleotide Sequence | TTGAAAAAAGAGAGAACAGAGAGTTTAGTCGCTCAAGCCTTAAAAAATATTGGGAATGATCGCTACATGCTAGATAATTTGGTTTTCGCTCGTGTGAAGCAACTAAACGCTGGAGCCAAAACTTTAGTGAATATGGACCCTAAGCGTCATAAATTAGTGGATATTGCTATCAGAGAAATCGCTGAAGGGAAAATTGATATAGACAGGATAGATGAACGAAATTGA |
Sequence | MKKERTESLVAQALKNIGNDRYMLDNLVFARVKQLNAGAKTLVNMDPKRHKLVDIAIREIAEGKIDIDRIDERN |
Source of smORF | Swiss-Prot |
Function | Promotes RNA polymerase assembly. Latches the N- and C-terminal regions of the beta' subunit thereby facilitating its interaction with the beta and alpha subunits (By similarity). {ECO:0000250}. |
Pubmed ID | 9923682 |
Domain | CDD:417484 |
Functional Category | Others |
Uniprot ID | P60326 |
ORF Length (Amino Acid) | 74 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 559034 | 559258 | + | NC_008229.1 | Helicobacter acinonychis str. Sheeba |
2 | 780211 | 780435 | - | NC_017379.1 | Helicobacter pylori Puno135 |
3 | 1491937 | 1492161 | - | NC_017735.1 | Helicobacter cetorum MIT 99-5656 |
4 | 810521 | 810745 | - | NC_004917.1 | Helicobacter hepaticus ATCC 51449 |
5 | 363036 | 363260 | - | NZ_AP018676.1 | Helicobacter cinaedi |
6 | 238044 | 238250 | + | NC_005090.1 | Wolinella succinogenes DSM 1740 |
7 | 244275 | 244499 | + | NZ_LN907858.1 | Helicobacter typhlonius |
8 | 330711 | 330929 | - | NC_014810.2 | Helicobacter felis ATCC 49179 |
9 | 681562 | 681771 | + | NZ_LS483446.1 | Helicobacter mustelae |
10 | 1198595 | 1198816 | - | NZ_CP014991.1 | Helicobacter himalayensis |
11 | 1045910 | 1046113 | - | NZ_CP063087.1 | Helicobacter winghamensis |
12 | 862639 | 862848 | + | NC_014935.1 | Nitratifractor salsuginis DSM 16511 |
13 | 647959 | 648177 | + | NZ_CP012544.1 | Campylobacter showae |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00696.30 | 0.92 | 12 | 43.0 | same-strand | Amino acid kinase family |
2 | PF13328.8 | 1.0 | 13 | 10 | same-strand | HD domain |
3 | PF04607.19 | 1.0 | 13 | 10 | same-strand | Region found in RelA / SpoT proteins |
4 | PF02824.23 | 1.0 | 13 | 10 | same-strand | TGS domain |
5 | PF00579.27 | 1.0 | 13 | 2196 | same-strand | tRNA synthetases class I (W and Y) |
6 | PF01479.27 | 0.62 | 8 | 2192.5 | same-strand | S4 domain |
7 | PF03060.17 | 1.0 | 13 | 3408 | same-strand | Nitronate monooxygenase |
8 | PF01520.20 | 1.0 | 13 | 4498 | same-strand | N-acetylmuramoyl-L-alanine amidase |
9 | PF01966.24 | 0.92 | 12 | 10.0 | same-strand | HD domain |