ProsmORF-pred
Result : P60326
Protein Information
Information Type Description
Protein name DNA-directed RNA polymerase subunit omega (RNAP omega subunit) (EC 2.7.7.6) (RNA polymerase omega subunit) (Transcriptase subunit omega)
NCBI Accession ID AE001439.1
Organism Helicobacter pylori (strain J99 / ATCC 700824) (Campylobacter pylori J99)
Left 792571
Right 792795
Strand -
Nucleotide Sequence TTGAAAAAAGAGAGAACAGAGAGTTTAGTCGCTCAAGCCTTAAAAAATATTGGGAATGATCGCTACATGCTAGATAATTTGGTTTTCGCTCGTGTGAAGCAACTAAACGCTGGAGCCAAAACTTTAGTGAATATGGACCCTAAGCGTCATAAATTAGTGGATATTGCTATCAGAGAAATCGCTGAAGGGAAAATTGATATAGACAGGATAGATGAACGAAATTGA
Sequence MKKERTESLVAQALKNIGNDRYMLDNLVFARVKQLNAGAKTLVNMDPKRHKLVDIAIREIAEGKIDIDRIDERN
Source of smORF Swiss-Prot
Function Promotes RNA polymerase assembly. Latches the N- and C-terminal regions of the beta' subunit thereby facilitating its interaction with the beta and alpha subunits (By similarity). {ECO:0000250}.
Pubmed ID 9923682
Domain CDD:417484
Functional Category Others
Uniprot ID P60326
ORF Length (Amino Acid) 74
++ More..
Conservation Analysis
Conservation Analysis
No. of Species: 13
Sr.No. Left Position Right Position Strand NCBI Accession id Species Name
1 559034 559258 + NC_008229.1 Helicobacter acinonychis str. Sheeba
2 780211 780435 - NC_017379.1 Helicobacter pylori Puno135
3 1491937 1492161 - NC_017735.1 Helicobacter cetorum MIT 99-5656
4 810521 810745 - NC_004917.1 Helicobacter hepaticus ATCC 51449
5 363036 363260 - NZ_AP018676.1 Helicobacter cinaedi
6 238044 238250 + NC_005090.1 Wolinella succinogenes DSM 1740
7 244275 244499 + NZ_LN907858.1 Helicobacter typhlonius
8 330711 330929 - NC_014810.2 Helicobacter felis ATCC 49179
9 681562 681771 + NZ_LS483446.1 Helicobacter mustelae
10 1198595 1198816 - NZ_CP014991.1 Helicobacter himalayensis
11 1045910 1046113 - NZ_CP063087.1 Helicobacter winghamensis
12 862639 862848 + NC_014935.1 Nitratifractor salsuginis DSM 16511
13 647959 648177 + NZ_CP012544.1 Campylobacter showae
++ More..
Neighborhood Conservation Analysis
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Conservation Analysis
Neighborhood Representative Chosen(Species): NC_017379.1
Sr.No. Domain Co-occurrence Frequency No. of species in which domain occurs with smORF Median distance b/w smORF and domain bearing ORFs Orientation relative to smORF PFAM Information
1 PF00696.30 0.92 12 43.0 same-strand Amino acid kinase family
2 PF13328.8 1.0 13 10 same-strand HD domain
3 PF04607.19 1.0 13 10 same-strand Region found in RelA / SpoT proteins
4 PF02824.23 1.0 13 10 same-strand TGS domain
5 PF00579.27 1.0 13 2196 same-strand tRNA synthetases class I (W and Y)
6 PF01479.27 0.62 8 2192.5 same-strand S4 domain
7 PF03060.17 1.0 13 3408 same-strand Nitronate monooxygenase
8 PF01520.20 1.0 13 4498 same-strand N-acetylmuramoyl-L-alanine amidase
9 PF01966.24 0.92 12 10.0 same-strand HD domain
++ More..