Protein Information |
Information Type | Description |
---|---|
Protein name | Competence-stimulating peptide type 1 (CSP-1) |
NCBI Accession ID | U76218.1 |
Organism | Streptococcus pneumoniae (strain ATCC BAA-255 / R6) |
Left | 811 |
Right | 936 |
Strand | + |
Nucleotide Sequence | ATGAAAAACACAGTTAAATTGGAACAGTTTGTAGCTTTGAAGGAAAAAGACTTACAAAAGATTAAAGGTGGGGAGATGAGGTTGTCAAAATTCTTCCGTGATTTTATTTTACAAAGAAAAAAGTAA |
Sequence | MKNTVKLEQFVALKEKDLQKIKGGEMRLSKFFRDFILQRKK |
Source of smORF | Swiss-Prot |
Function | Acts as a pheromone, induces cells to develop competence for genetic transformation. |
Pubmed ID | 9157240 10322016 11544234 |
Domain | CDD:380213,CDD:383496 |
Functional Category | Others |
Uniprot ID | P60243 |
ORF Length (Amino Acid) | 41 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 2187456 | 2187581 | - | NC_015875.1 | Streptococcus pseudopneumoniae IS7493 |
2 | 1798770 | 1798892 | + | NZ_CP032621.1 | Streptococcus gwangjuense |
3 | 1928248 | 1928373 | - | NZ_LR134336.1 | Streptococcus oralis ATCC 35037 |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF09586.12 | 1.0 | 3 | 5680 | opposite-strand | Bacterial membrane protein YfhO |
2 | PF14278.8 | 1.0 | 3 | 2338 | opposite-strand | Transcriptional regulator C-terminal region |
3 | PF00440.25 | 1.0 | 3 | 2338 | opposite-strand | Bacterial regulatory proteins, tetR family |
4 | PF04397.17 | 1.0 | 3 | 1343 | same-strand | LytTr DNA-binding domain |
5 | PF00072.26 | 1.0 | 3 | 1343 | same-strand | Response regulator receiver domain |
6 | PF14501.8 | 1.0 | 3 | 21 | same-strand | GHKL domain |
7 | PF02518.28 | 0.67 | 2 | 19.0 | same-strand | Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase |
8 | PF02590.19 | 1.0 | 3 | 282 | same-strand | Predicted SPOUT methyltransferase |
9 | PF13365.8 | 1.0 | 3 | 947 | opposite-strand | Trypsin-like peptidase domain |
10 | PF13180.8 | 1.0 | 3 | 947 | opposite-strand | PDZ domain |
11 | PF00089.28 | 1.0 | 3 | 947 | opposite-strand | Trypsin |
12 | PF02195.20 | 1.0 | 3 | 2201 | opposite-strand | ParB-like nuclease domain |
13 | PF17762.3 | 1.0 | 3 | 2201 | opposite-strand | HTH domain found in ParB protein |