ProsmORF-pred
Result : P60077
Protein Information
Information Type Description
Protein name UPF0291 protein SA2360
NCBI Accession ID BA000018.3
Organism Staphylococcus aureus (strain N315)
Left 2652387
Right 2652617
Strand +
Nucleotide Sequence ATGAAAATTTTAGATAGAATTAATGAACTTGCAAATAAAGAAAAAGTCCAACCACTTACTGTAGCTGAAAAACAAGAACAACATGCATTGCGTCAAGACTACTTAAGTATGATCCGAGGACAAGTATTAACAACATTTTCCACAATAAAAGTGGTTGATCCAATCGGTCAGGATGTCACACCAGATAAAGTTTATGATCTTCGCCAACAATACGGTTATATTCAAAATTAA
Sequence MKILDRINELANKEKVQPLTVAEKQEQHALRQDYLSMIRGQVLTTFSTIKVVDPIGQDVTPDKVYDLRQQYGYIQN
Source of smORF Swiss-Prot
Function The ORF matches to the profile of cl01722. Profile Description: Bacterial protein of unknown function (DUF896). hypothetical protein; Provisional
Pubmed ID 11418146
Domain CDD:413030
Functional Category Others
Uniprot ID P60077
ORF Length (Amino Acid) 76
++ More..
Conservation Analysis
Conservation Analysis
No. of Species: 61
Sr.No. Left Position Right Position Strand NCBI Accession id Species Name
1 2664945 2665175 + NC_007795.1 Staphylococcus aureus subsp. aureus NCTC 8325
2 2625992 2626222 + NZ_LR134304.1 Staphylococcus schweitzeri
3 2489895 2490125 + NZ_LT906460.1 Staphylococcus simiae
4 1123269 1123505 + NC_022737.1 Staphylococcus pasteuri SP1
5 451447 451677 - NZ_AP018587.1 Staphylococcus caprae
6 349791 350015 - NZ_LR134242.1 Staphylococcus warneri
7 1864149 1864391 - NZ_CP014022.1 Staphylococcus lugdunensis
8 2109931 2110167 + NZ_CP013911.1 Staphylococcus haemolyticus
9 1197983 1198219 - NZ_CP033732.1 Staphylococcus hominis
10 373047 373280 - NZ_CP008724.1 Staphylococcus xylosus
11 125497 125736 - NZ_CP018776.1 Staphylococcus condimenti
12 300048 300287 - NZ_CP033460.1 Staphylococcus debuckii
13 2319770 2320003 - NZ_CP018199.1 Staphylococcus succinus
14 318649 318882 - NZ_LR134089.1 Staphylococcus saprophyticus
15 2360526 2360759 + NZ_CP013114.1 Staphylococcus equorum
16 3428326 3428553 + NZ_CP043611.1 Paenibacillus antarcticus
17 1264368 1264601 + NZ_CP011366.1 Salinicoccus halodurans
18 427385 427600 + NZ_CP014616.1 Sporosarcina psychrophila
19 2697776 2698003 + NC_017672.3 Paenibacillus mucilaginosus K02
20 2702517 2702714 - NZ_CP016539.2 Planococcus plakortidis
21 2796805 2797023 - NZ_CP016543.2 Planococcus donghaensis
22 196118 196339 - NZ_CP016809.1 Paenibacillus ihbetae
23 2586069 2586266 - NZ_CP013659.2 Planococcus rifietoensis
24 3737044 3737277 - NZ_CP018622.1 Virgibacillus dokdonensis
25 1321341 1321580 + NZ_LR134167.1 Avibacterium volantium
26 3492837 3493067 - NZ_CP013023.1 Paenibacillus bovis
27 2897617 2897835 - NZ_CP016537.2 Planococcus halocryophilus
28 839398 839634 + NZ_CP068061.1 Mammaliicoccus vitulinus
29 2309439 2309678 + NZ_CP013661.2 Planococcus kocurii
30 2952510 2952749 - NZ_CP019401.1 Planococcus faecalis
31 2795433 2795651 - NZ_CP016540.2 Planococcus versutus
32 2032270 2032467 - NZ_CP016540.2 Planococcus versutus
33 1405969 1406202 - NC_018704.1 Amphibacillus xylanus NBRC 15112
34 1862335 1862526 + NZ_CP029797.1 Paraliobacillus zengyii
35 1344322 1344552 - NZ_CP011361.2 Salimicrobium jeotgali
36 3183372 3183590 - NZ_CP022315.1 Virgibacillus phasianinus
37 1147782 1148018 + NC_010556.1 Exiguobacterium sibiricum 255-15
38 2791089 2791286 - NZ_CP059540.1 Planococcus maritimus
39 3140993 3141193 + NZ_CP015108.1 Sporosarcina ureae
40 2769374 2769571 - NZ_CP016538.2 Planococcus maritimus
41 3615458 3615658 - NZ_CP009428.1 Paenibacillus odorifer
42 527681 527941 + NZ_CP002082.1 Spiroplasma mirum ATCC 29335
43 555557 555817 + NZ_CP011855.1 Spiroplasma atrichopogonis
44 2169848 2170090 + NZ_CP049887.1 Vagococcus hydrophili
45 420743 420937 - NZ_CP059563.1 Conchiformibius steedae
46 4737166 4737393 - NZ_CP045293.1 Paenibacillus guangzhouensis
47 457052 457285 + NZ_CP015029.1 Frederiksenia canicola
48 190559 190798 - NZ_CP014161.1 Aerococcus urinae
49 3546453 3546683 - NZ_CP043404.1 Bacillus safensis
50 768676 768891 - NZ_CP024870.1 Spiroplasma clarkii
51 622066 622299 + NZ_CP011856.1 Spiroplasma eriocheiris
52 2006559 2006792 + NZ_LT906434.1 Neisseria zoodegmatis
53 1860034 1860276 + NZ_CP023392.1 Lactococcus raffinolactis
54 2203257 2203490 + NZ_CP042593.1 Bacillus dafuensis
55 916368 916604 - NZ_LR134516.1 Neisseria animaloris
56 314910 315113 + NZ_LR134523.1 Peptoniphilus ivorii
57 1807659 1807889 - NZ_CP032365.1 Bacillus wiedmannii
58 1746271 1746501 - NZ_CP064875.1 Bacillus toyonensis
59 1634600 1634800 - NZ_CP031700.1 Neisseria zalophi
60 1808055 1808255 - NC_011725.1 Bacillus cereus B4264
61 2466219 2466419 + NZ_CP060414.1 Neisseria musculi
62 2172651 2172872 + NZ_CP059567.1 Neisseria shayeganii
63 580004 580234 - NZ_LR134313.1 Neisseria canis
++ More..