Result : P60072
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | UPF0291 protein lin0497 |
| NCBI Accession ID | AL596165.1 |
| Organism | Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262) |
| Left | 64860 |
| Right | 65084 |
| Strand | + |
| Nucleotide Sequence | ATGAAATTGTTATTAAAAAATATTAATGAACTTGCTGCAAAACAAAAAAGTGAAGGATTAACTGCTTTTGAAAAAGAAAGACAAGCTGCCCTTCGTCAAGAATATTTGAAGAAAATTAGAGGAACTGTTCAAGATAATTTGCATCACGTAACAATCATTGATCCACTTGGAGACGATGTAACTCCTAAAAAACTAAAAGAAATCCAAGCCGAATTAAGAGGCTGA |
| Sequence | MKLLLKNINELAAKQKSEGLTAFEKERQAALRQEYLKKIRGTVQDNLHHVTIIDPLGDDVTPKKLKEIQAELRG |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl01722. Profile Description: Bacterial protein of unknown function (DUF896). hypothetical protein; Provisional |
| Pubmed ID | 11679669 |
| Domain | CDD:413030 |
| Functional Category | Others |
| Uniprot ID | P60072 |
| ORF Length (Amino Acid) | 74 |
++ More..
| Conservation Analysis |
No. of Species: 96
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 498932 | 499156 | + | NZ_LT906444.1 | Listeria welshimeri |
| 2 | 532328 | 532552 | + | NC_003210.1 | Listeria monocytogenes EGD-e |
| 3 | 495878 | 496102 | + | NZ_CP009577.1 | Listeria ivanovii subsp. ivanovii |
| 4 | 435788 | 436012 | + | NC_013891.1 | Listeria seeligeri serovar 1/2b str. SLCC3954 |
| 5 | 190559 | 190798 | - | NZ_CP014161.1 | Aerococcus urinae |
| 6 | 777328 | 777558 | + | NZ_CP064060.1 | Anoxybacillus caldiproteolyticus |
| 7 | 1264368 | 1264601 | + | NZ_CP011366.1 | Salinicoccus halodurans |
| 8 | 2131742 | 2131975 | + | NC_017668.1 | Halobacillus halophilus DSM 2266 |
| 9 | 1568580 | 1568816 | - | NZ_CP008747.1 | Staphylococcus hyicus |
| 10 | 3428326 | 3428553 | + | NZ_CP043611.1 | Paenibacillus antarcticus |
| 11 | 2074438 | 2074689 | - | NZ_CP019728.1 | Jeotgalibaca dankookensis |
| 12 | 1355318 | 1355548 | + | NC_006510.1 | Geobacillus kaustophilus HTA426 |
| 13 | 805049 | 805279 | + | NZ_CP061472.1 | Geobacillus thermoleovorans |
| 14 | 5230929 | 5231135 | - | NZ_CP041217.1 | Saccharibacillus brassicae |
| 15 | 2346422 | 2346658 | + | NZ_CP020773.1 | Staphylococcus lutrae |
| 16 | 2627464 | 2627694 | - | NZ_CP018058.1 | Geobacillus thermocatenulatus |
| 17 | 2013264 | 2013494 | - | NZ_CP014342.1 | Geobacillus subterraneus |
| 18 | 445550 | 445780 | + | NZ_CP061470.1 | Geobacillus zalihae |
| 19 | 3070188 | 3070418 | - | NZ_CP017703.1 | Aeribacillus pallidus |
| 20 | 988159 | 988395 | + | NZ_CP045927.1 | Staphylococcus agnetis |
| 21 | 196118 | 196339 | - | NZ_CP016809.1 | Paenibacillus ihbetae |
| 22 | 427385 | 427600 | + | NZ_CP014616.1 | Sporosarcina psychrophila |
| 23 | 1838359 | 1838586 | + | NC_016641.1 | Paenibacillus terrae HPL-003 |
| 24 | 2329784 | 2330017 | - | NZ_CP020772.1 | Halobacillus mangrovi |
| 25 | 2635915 | 2636127 | - | NZ_CP070511.1 | Parageobacillus toebii |
| 26 | 2165805 | 2166059 | - | NZ_CP023011.2 | Enterococcus hirae |
| 27 | 1324143 | 1324379 | - | NZ_CP022046.2 | Mammaliicoccus sciuri |
| 28 | 4023761 | 4023976 | + | NZ_CP054614.1 | Paenibacillus barcinonensis |
| 29 | 1816353 | 1816589 | + | NZ_CP027770.1 | Staphylococcus felis |
| 30 | 1129822 | 1130058 | + | NC_014925.1 | Staphylococcus pseudintermedius HKU10-03 |
| 31 | 2515902 | 2516129 | + | NZ_CP045298.1 | Paenibacillus brasilensis |
| 32 | 4521481 | 4521714 | + | NZ_CP030926.1 | Peribacillus butanolivorans |
| 33 | 2702517 | 2702726 | - | NZ_CP016539.2 | Planococcus plakortidis |
| 34 | 318649 | 318882 | - | NZ_LR134089.1 | Staphylococcus saprophyticus |
| 35 | 1862335 | 1862526 | + | NZ_CP029797.1 | Paraliobacillus zengyii |
| 36 | 2586069 | 2586278 | - | NZ_CP013659.2 | Planococcus rifietoensis |
| 37 | 3492837 | 3493067 | - | NZ_CP013023.1 | Paenibacillus bovis |
| 38 | 2309439 | 2309678 | + | NZ_CP013661.2 | Planococcus kocurii |
| 39 | 2952510 | 2952749 | - | NZ_CP019401.1 | Planococcus faecalis |
| 40 | 4787194 | 4787391 | - | NZ_CP041305.1 | Cytobacillus ciccensis |
| 41 | 2449028 | 2449240 | - | NZ_CP018866.1 | Sutcliffiella cohnii |
| 42 | 1673267 | 1673464 | + | NZ_CP009416.1 | Jeotgalibacillus malaysiensis |
| 43 | 1299218 | 1299454 | - | NZ_LT906464.1 | Staphylococcus muscae |
| 44 | 655671 | 655904 | - | NZ_CP017704.1 | Peribacillus simplex NBRC 15720 = DSM 1321 |
| 45 | 5423220 | 5423447 | - | NZ_CP020028.1 | Paenibacillus kribbensis |
| 46 | 1684599 | 1684835 | + | NZ_CP041666.1 | Radiobacillus deserti |
| 47 | 2161956 | 2162189 | + | NZ_LT603683.1 | Bacillus glycinifermentans |
| 48 | 1811297 | 1811536 | - | NC_020995.1 | Enterococcus casseliflavus EC20 |
| 49 | 3615458 | 3615658 | - | NZ_CP009428.1 | Paenibacillus odorifer |
| 50 | 839398 | 839634 | + | NZ_CP068061.1 | Mammaliicoccus vitulinus |
| 51 | 597020 | 597238 | - | NZ_CP065729.1 | Macrococcus caseolyticus |
| 52 | 2487225 | 2487461 | + | NC_022737.1 | Staphylococcus pasteuri SP1 |
| 53 | 1405969 | 1406202 | - | NC_018704.1 | Amphibacillus xylanus NBRC 15112 |
| 54 | 2169848 | 2170090 | + | NZ_CP049887.1 | Vagococcus hydrophili |
| 55 | 1978744 | 1978977 | + | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 56 | 2029330 | 2029563 | + | NZ_CP023665.1 | Bacillus paralicheniformis |
| 57 | 1712388 | 1712585 | + | NC_004193.1 | Oceanobacillus iheyensis HTE831 |
| 58 | 1962903 | 1963115 | + | NZ_CP016622.1 | Parageobacillus thermoglucosidasius |
| 59 | 1948371 | 1948604 | - | NZ_CP038015.1 | Paenisporosarcina antarctica |
| 60 | 1115233 | 1115451 | + | NZ_CP047361.1 | Macrococcus canis |
| 61 | 1498392 | 1498628 | - | NZ_LR134242.1 | Staphylococcus warneri |
| 62 | 1668438 | 1668671 | + | NZ_CP011102.1 | Listeria weihenstephanensis |
| 63 | 451447 | 451677 | - | NZ_AP018587.1 | Staphylococcus caprae |
| 64 | 16311 | 16541 | - | NZ_CP022983.1 | Cytobacillus kochii |
| 65 | 457052 | 457285 | + | NZ_CP015029.1 | Frederiksenia canicola |
| 66 | 622003 | 622260 | + | NZ_LR134336.1 | Streptococcus oralis ATCC 35037 |
| 67 | 1565721 | 1565915 | + | NZ_CP015438.1 | Anoxybacillus amylolyticus |
| 68 | 1821405 | 1821656 | + | NZ_CP053988.1 | Abiotrophia defectiva |
| 69 | 1141462 | 1141701 | + | NZ_LS483306.1 | Enterococcus cecorum |
| 70 | 506312 | 506509 | + | NZ_CP032621.1 | Streptococcus gwangjuense |
| 71 | 1883347 | 1883580 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 72 | 1383380 | 1383577 | - | NC_015875.1 | Streptococcus pseudopneumoniae IS7493 |
| 73 | 2769374 | 2769583 | - | NZ_CP016538.2 | Planococcus maritimus |
| 74 | 2791089 | 2791298 | - | NZ_CP059540.1 | Planococcus maritimus |
| 75 | 1546355 | 1546594 | - | NZ_CP023074.1 | Enterococcus thailandicus |
| 76 | 722146 | 722397 | + | NZ_CP045240.1 | Limosilactobacillus vaginalis |
| 77 | 1827776 | 1828009 | + | NZ_CP013984.1 | Bacillus inaquosorum |
| 78 | 1919459 | 1919692 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 79 | 2559502 | 2559735 | + | NZ_CP053989.1 | Niallia circulans |
| 80 | 2087038 | 2087235 | - | NZ_CP011937.1 | Bacillus velezensis |
| 81 | 1868599 | 1868796 | + | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 82 | 1786349 | 1786603 | - | NZ_LT906439.1 | Streptococcus merionis |
| 83 | 2203257 | 2203490 | + | NZ_CP042593.1 | Bacillus dafuensis |
| 84 | 3546453 | 3546683 | - | NZ_CP043404.1 | Bacillus safensis |
| 85 | 1769111 | 1769341 | + | NZ_CP011150.1 | Bacillus altitudinis |
| 86 | 2070226 | 2070468 | - | NZ_CP060720.1 | Vagococcus carniphilus |
| 87 | 2265686 | 2265910 | + | NZ_CP034437.1 | Paenibacillus albus |
| 88 | 2206524 | 2206754 | - | NZ_CP016020.1 | Bacillus weihaiensis |
| 89 | 1785391 | 1785612 | + | NZ_CP015378.1 | Fictibacillus phosphorivorans |
| 90 | 1908805 | 1909026 | + | NC_022524.1 | Bacillus infantis NRRL B-14911 |
| 91 | 818624 | 818821 | + | NZ_CP022680.1 | Streptococcus respiraculi |
| 92 | 754269 | 754490 | + | NZ_CP045605.1 | Limosilactobacillus reuteri |
| 93 | 2466219 | 2466419 | + | NZ_CP060414.1 | Neisseria musculi |
| 94 | 2593123 | 2593344 | - | NC_014829.1 | Evansella cellulosilytica DSM 2522 |
| 95 | 3556459 | 3556689 | - | NZ_CP017786.1 | Bacillus xiamenensis |
| 96 | 1099801 | 1100025 | + | NZ_LR134533.1 | Neisseria weaveri |
| 97 | 580004 | 580243 | - | NZ_LR134313.1 | Neisseria canis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP064060.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00717.25 | 0.65 | 62 | 1195.0 | opposite-strand | Peptidase S24-like |
| 2 | PF01726.18 | 0.65 | 62 | 1195.0 | opposite-strand | LexA DNA binding domain |
| 3 | PF00456.23 | 0.6 | 58 | 124.0 | same-strand | Transketolase, thiamine diphosphate binding domain |
| 4 | PF02779.26 | 0.6 | 58 | 124.0 | same-strand | Transketolase, pyrimidine binding domain |
++ More..