Result : P59908
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Photosystem II protein Y |
| NCBI Accession ID | BX569691.1 |
| Organism | Synechococcus sp. (strain WH8102) |
| Left | 162783 |
| Right | 162914 |
| Strand | + |
| Nucleotide Sequence | GTGCTGGGTATTGATGCTCGCCTGTTCCTCGTCGTGGCCCCAATCCTGGCCGCTGTGAGCTGGGCCGCCTTCAACATCGGCCGTGCCGCCGTCGGTCAGCTGCAGCTGCTGATCAAGCGCAGCCGCGCCTGA |
| Sequence | MLGIDARLFLVVAPILAAVSWAAFNIGRAAVGQLQLLIKRSRA |
| Source of smORF | Swiss-Prot |
| Function | Manganese-binding polypeptide with L-arginine metabolizing enzyme activity. Component of the core of photosystem II. {ECO:0000255|HAMAP-Rule:MF_00717}. |
| Pubmed ID | 12917641 |
| Domain | CDD:421422 |
| Functional Category | Others |
| Uniprot ID | P59908 |
| ORF Length (Amino Acid) | 43 |
++ More..
| Conservation Analysis |
No. of Species: 3
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 893688 | 893810 | + | NC_019675.1 | Cyanobium gracile PCC 6307 |
| 2 | 2995960 | 2996085 | - | NC_014501.1 | Gloeothece verrucosa PCC 7822 |
| 3 | 5902107 | 5902232 | + | NZ_CP047242.1 | Trichormus variabilis 0441 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_014501.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00132.26 | 1.0 | 3 | 66 | same-strand | Bacterial transferase hexapeptide (six repeats) |
| 2 | PF14602.8 | 1.0 | 3 | 66 | same-strand | Hexapeptide repeat of succinyl-transferase |
| 3 | PF09654.12 | 0.67 | 2 | 814.0 | opposite-strand | Protein of unknown function (DUF2396) |
| 4 | PF00903.27 | 0.67 | 2 | 1470.5 | opposite-strand | Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily |
++ More..