Protein Information |
Information Type | Description |
---|---|
Protein name | Photosystem II protein Y |
NCBI Accession ID | BX569691.1 |
Organism | Synechococcus sp. (strain WH8102) |
Left | 162783 |
Right | 162914 |
Strand | + |
Nucleotide Sequence | GTGCTGGGTATTGATGCTCGCCTGTTCCTCGTCGTGGCCCCAATCCTGGCCGCTGTGAGCTGGGCCGCCTTCAACATCGGCCGTGCCGCCGTCGGTCAGCTGCAGCTGCTGATCAAGCGCAGCCGCGCCTGA |
Sequence | MLGIDARLFLVVAPILAAVSWAAFNIGRAAVGQLQLLIKRSRA |
Source of smORF | Swiss-Prot |
Function | Manganese-binding polypeptide with L-arginine metabolizing enzyme activity. Component of the core of photosystem II. {ECO:0000255|HAMAP-Rule:MF_00717}. |
Pubmed ID | 12917641 |
Domain | CDD:421422 |
Functional Category | Others |
Uniprot ID | P59908 |
ORF Length (Amino Acid) | 43 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 893688 | 893810 | + | NC_019675.1 | Cyanobium gracile PCC 6307 |
2 | 2995960 | 2996085 | - | NC_014501.1 | Gloeothece verrucosa PCC 7822 |
3 | 5902107 | 5902232 | + | NZ_CP047242.1 | Trichormus variabilis 0441 |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00132.26 | 1.0 | 3 | 66 | same-strand | Bacterial transferase hexapeptide (six repeats) |
2 | PF14602.8 | 1.0 | 3 | 66 | same-strand | Hexapeptide repeat of succinyl-transferase |
3 | PF09654.12 | 0.67 | 2 | 814.0 | opposite-strand | Protein of unknown function (DUF2396) |
4 | PF00903.27 | 0.67 | 2 | 1470.5 | opposite-strand | Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily |