Result : A5ILC9
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | DNA-directed RNA polymerase subunit omega (RNAP omega subunit) (EC 2.7.7.6) (RNA polymerase omega subunit) (Transcriptase subunit omega) |
| NCBI Accession ID | CP000702.1 |
| Organism | Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) |
| Left | 1015713 |
| Right | 1015952 |
| Strand | - |
| Nucleotide Sequence | ATGGAAAAGATGGTGAAGTTCAATCTCAGGTACGATGAACTGTTGAAGAAGATACCATACAAGTACGCTATACCTGTTGTTGTGGCAAAGCGTGCGGAAGCGATCAGAGAATACGCCAAACCGTTTGTGATCACAGATGATGAGAATCCTGTAAGTATCGCCTTCATGGAGCTCAGCCTGAATTACATCAGGATCAAAAACGAGGAGATACTGAAAGCGCTCATTCCGAAGGTGAAGTGA |
| Sequence | MEKMVKFNLRYDELLKKIPYKYAIPVVVAKRAEAIREYAKPFVITDDENPVSIAFMELSLNYIRIKNEEILKALIPKVK |
| Source of smORF | Swiss-Prot |
| Function | Promotes RNA polymerase assembly. Latches the N- and C-terminal regions of the beta' subunit thereby facilitating its interaction with the beta and alpha subunits. {ECO:0000255|HAMAP-Rule:MF_00366}. |
| Pubmed ID | |
| Domain | CDD:417484 |
| Functional Category | Others |
| Uniprot ID | A5ILC9 |
| ORF Length (Amino Acid) | 79 |
++ More..
| Conservation Analysis |
No. of Species: 15
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1015713 | 1015952 | - | NC_009486.1 | Thermotoga petrophila RKU-1 |
| 2 | 1153763 | 1154002 | + | NC_013642.1 | Thermotoga naphthophila RKU-10 |
| 3 | 1146951 | 1147190 | + | NC_023151.1 | Thermotoga maritima MSB8 |
| 4 | 873038 | 873277 | - | NC_011978.1 | Thermotoga neapolitana DSM 4359 |
| 5 | 1514023 | 1514238 | - | NZ_AP014509.1 | Thermotoga caldifontis AZM44c09 |
| 6 | 56986 | 57204 | + | NC_015707.1 | Pseudothermotoga thermarum DSM 5069 |
| 7 | 1549718 | 1549948 | + | NC_022795.1 | Pseudothermotoga hypogea DSM 11164 = NBRC 106472 |
| 8 | 1278289 | 1278528 | - | NZ_AP014510.1 | Thermotoga profunda AZM34c06 |
| 9 | 2058610 | 2058807 | + | NC_017095.1 | Fervidobacterium pennivorans DSM 9078 |
| 10 | 1825729 | 1825959 | - | NC_009718.1 | Fervidobacterium nodosum Rt17-B1 |
| 11 | 2098833 | 2099033 | + | NZ_CP014334.1 | Fervidobacterium islandicum |
| 12 | 336303 | 336530 | - | NC_011653.1 | Thermosipho africanus TCF52B |
| 13 | 1696321 | 1696521 | - | NC_009828.1 | Pseudothermotoga lettingae TMO |
| 14 | 1731376 | 1731576 | - | NC_022792.1 | Pseudothermotoga elfii DSM 9442 = NBRC 107921 |
| 15 | 102732 | 102959 | - | NZ_CP007389.1 | Thermosipho melanesiensis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_009486.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01197.20 | 0.67 | 10 | 2713.0 | opposite-strand | Ribosomal protein L31 |
| 2 | PF00575.25 | 0.67 | 10 | 2317.0 | opposite-strand | S1 RNA binding domain |
| 3 | PF03734.16 | 0.67 | 10 | 1144.5 | same-strand | L,D-transpeptidase catalytic domain |
| 4 | PF01476.22 | 0.67 | 10 | 1144.5 | same-strand | LysM domain |
| 5 | PF04127.17 | 0.67 | 10 | 3.0 | same-strand | DNA / pantothenate metabolism flavoprotein |
| 6 | PF02441.21 | 0.67 | 10 | 3.0 | same-strand | Flavoprotein |
| 7 | PF00625.23 | 0.93 | 14 | -5.0 | same-strand | Guanylate kinase |
| 8 | PF13238.8 | 0.73 | 11 | -3 | same-strand | AAA domain |
| 9 | PF04025.14 | 1.0 | 15 | 625 | same-strand | Domain of unknown function (DUF370) |
| 10 | PF03755.15 | 1.0 | 15 | 924 | same-strand | YicC-like family, N-terminal region |
| 11 | PF08340.13 | 1.0 | 15 | 924 | same-strand | Domain of unknown function (DUF1732) |
++ More..