Result : P58992
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Rubredoxin-1 (Rd 1) |
| NCBI Accession ID | AE006470.1 |
| Organism | Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) (Chlorobium tepidum) |
| Left | 1036731 |
| Right | 1036940 |
| Strand | + |
| Nucleotide Sequence | ATGAACGTCAAGGAGAGCGAACCGGCACAGGCCGACCTGCAGGCATCATGGATGTGCGCCGAATGCGGCTACATTTACGATCCCGCAGAGGGTAATCTCGAAACGAACATCCGTCCCGGCATGCCTTTCGACAAGCTGCCGGATGACTGGAGCTGCCCGGTGTGCAATCACCCGAAAAACCAGTTCACAAAATTCATTTCTCAGCTCTGA |
| Sequence | MNVKESEPAQADLQASWMCAECGYIYDPAEGNLETNIRPGMPFDKLPDDWSCPVCNHPKNQFTKFISQL |
| Source of smORF | Swiss-Prot |
| Function | Serves as an electron acceptor for pyruvate ferredoxin oxidoreductase (PFOR). {ECO:0000250}. |
| Pubmed ID | 12093901 |
| Domain | CDD:412217 |
| Functional Category | Metal-binding |
| Uniprot ID | P58992 |
| ORF Length (Amino Acid) | 69 |
++ More..
| Conservation Analysis |
No. of Species: 4
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1036731 | 1036940 | + | NC_002932.3 | Chlorobaculum tepidum TLS |
| 2 | 1246761 | 1246967 | - | NZ_CP017305.1 | Chlorobaculum limnaeum |
| 3 | 1103756 | 1103962 | - | NC_011027.1 | Chlorobaculum parvum NCIB 8327 |
| 4 | 1123311 | 1123487 | - | NZ_CP008796.1 | Thermodesulfobacterium commune DSM 2178 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_002932.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00005.29 | 0.75 | 3 | 4620 | opposite-strand | ABC transporter |
| 2 | PF13401.8 | 0.75 | 3 | 4620 | opposite-strand | AAA domain |
| 3 | PF01169.21 | 0.75 | 3 | 1280 | opposite-strand | Uncharacterized protein family UPF0016 |
| 4 | PF08212.14 | 0.75 | 3 | 644 | opposite-strand | Lipocalin-like domain |
| 5 | PF00061.25 | 0.75 | 3 | 644 | opposite-strand | Lipocalin / cytosolic fatty-acid binding protein family |
| 6 | PF00301.22 | 1.0 | 4 | 28 | same-strand | Rubredoxin |
| 7 | PF02687.23 | 0.75 | 3 | 1072.5 | opposite-strand | FtsX-like permease family |
| 8 | PF12704.9 | 0.75 | 3 | 1072.5 | opposite-strand | MacB-like periplasmic core domain |
++ More..