ProsmORF-pred
Result : P58569
Protein Information
Information Type Description
Protein name PsaJ-like protein asl3190
NCBI Accession ID BA000019.2
Organism Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Left 3859947
Right 3860099
Strand -
Nucleotide Sequence ATGAATAAATCACAAGATAAAGAGAAAAAATATTTCCTCGAATATCTCTCTCTGGCACCAGTTCTTGCTGTTATATCCATATCAGTTGCCTTTTCTACATGGGCAATTTTTAACTATATTTTTCCCGATCTTCTTTTCCATCCTCTACCATAA
Sequence MNKSQDKEKKYFLEYLSLAPVLAVISISVAFSTWAIFNYIFPDLLFHPLP
Source of smORF Swiss-Prot
Function The ORF matches to the profile of cl23820. Profile Description: Photosystem I reaction centre subunit IX / PsaJ. photosystem I reaction center subunit IX; Provisional
Pubmed ID 11759840
Domain CDD:420030
Functional Category Others
Uniprot ID P58569
ORF Length (Amino Acid) 50
++ More..
Conservation Analysis
Conservation Analysis
No. of Species: 7
Sr.No. Left Position Right Position Strand NCBI Accession id Species Name
1 6155724 6155876 - NZ_CP047242.1 Trichormus variabilis 0441
2 296588 296743 + NC_010628.1 Nostoc punctiforme PCC 73102
3 2019950 2020099 + NZ_CP024785.1 Nostoc flagelliforme CCNUN1
4 2027964 2028119 - NC_019695.1 Chroococcidiopsis thermalis PCC 7203
5 2028341 2028475 - NC_019695.1 Chroococcidiopsis thermalis PCC 7203
6 750425 750550 - NZ_AP018202.1 Thermostichus vulcanus NIES-2134
7 2524509 2524634 + NC_004113.1 Thermosynechococcus vestitus BP-1
8 1141805 1141933 + NC_019729.1 Oscillatoria nigro-viridis PCC 7112
++ More..