Protein Information |
Information Type | Description |
---|---|
Protein name | Photosystem I 4.8 kDa protein |
NCBI Accession ID | BA000019.2 |
Organism | Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576) |
Left | 1526610 |
Right | 1526744 |
Strand | + |
Nucleotide Sequence | ATGGCTAAGGCCAAAATTTCCCCAGTTGCTAATACCGGCGCTAAACCCCCCTATACTTTTCGTACAGGTTGGGCATTGTTGCTACTAGCTGTTAACTTCCTGGTAGCAGCCTATTATTTCCACATTATTCAATAG |
Sequence | MAKAKISPVANTGAKPPYTFRTGWALLLLAVNFLVAAYYFHIIQ |
Source of smORF | Swiss-Prot |
Function | The ORF matches to the profile of pfam08078. Profile Description: PsaX family. This family consists of the PsaX family of photosystem I (PSI) protein subunits. PSI is a large multi-subunit pigment protein complex embedded in the thylakoid membranes of green plants and cyanobacteria. PsaX is one of the 12 protein subunits found in PSI and these subunits are arranged as monomers or trimers within the membrane as shown by the structure of the trimeric complex from Synechococcus elongatus. |
Pubmed ID | 11759840 24550276 |
Domain | CDD:369686 |
Functional Category | Others |
Uniprot ID | P58566 |
ORF Length (Amino Acid) | 44 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 5043719 | 5043853 | + | NZ_CP047242.1 | Trichormus variabilis 0441 |
2 | 5601305 | 5601442 | + | NZ_CP031941.1 | Nostoc sphaeroides |
3 | 3020630 | 3020767 | + | NZ_CP054698.1 | Nostoc edaphicum CCNP1411 |
4 | 4246355 | 4246495 | + | NZ_CP024785.1 | Nostoc flagelliforme CCNUN1 |
5 | 1600219 | 1600329 | + | NZ_CP018092.1 | Synechococcus lividus PCC 6715 |
6 | 5460576 | 5460692 | + | NC_019771.1 | Anabaena cylindrica PCC 7122 |
7 | 5449394 | 5449540 | - | NC_019729.1 | Oscillatoria nigro-viridis PCC 7112 |
8 | 840354 | 840464 | + | NC_004113.1 | Thermosynechococcus vestitus BP-1 |
9 | 219042 | 219152 | - | NZ_AP018202.1 | Thermostichus vulcanus NIES-2134 |
10 | 6218193 | 6218327 | + | NC_019751.1 | Calothrix sp. PCC 6303 |
11 | 741670 | 741810 | + | NZ_CP042326.1 | Euhalothece natronophila Z-M001 |
12 | 410548 | 410664 | - | NC_019780.1 | Dactylococcopsis salina PCC 8305 |
13 | 1353382 | 1353525 | - | NC_019753.1 | Crinalium epipsammum PCC 9333 |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00072.26 | 0.69 | 9 | 1468.0 | opposite-strand | Response regulator receiver domain |
2 | PF04055.23 | 0.77 | 10 | 149.0 | same-strand | Radical SAM superfamily |