| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Glutamyl-tRNA(Gln) amidotransferase subunit C (Glu-ADT subunit C) (EC 6.3.5.-) |
| NCBI Accession ID | U49269.2 |
| Organism | Moraxella catarrhalis (Branhamella catarrhalis) |
| Left | 41 |
| Right | 328 |
| Strand | + |
| Nucleotide Sequence | ATGACCATCACCACCGAAGACATTTTGGACTGTGCAAATTTATCACGCCTTGCTCTTGATGAAAAAACCGCCCAAAACTATGCAGGCAATTTGGATAAAATCCTAGCCATGATGGACATATTAGATGGCGTAAACACTGATAATATCAAGCCTTTGGCAAATATCCACGAAGCTTGTAATGAGCTGCGTGCCGACATTGCCAATTCTGACATTGGCCGAGACGGTTTTCAAGCGGTTGCCCCTATGGTGCAAGATGGGTTATATTTGGTGCCACAGGTGATTGAATAA |
| Sequence | MTITTEDILDCANLSRLALDEKTAQNYAGNLDKILAMMDILDGVNTDNIKPLANIHEACNELRADIANSDIGRDGFQAVAPMVQDGLYLVPQVIE |
| Source of smORF | Swiss-Prot |
| Function | Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln). {ECO:0000255|HAMAP-Rule:MF_00122}. |
| Pubmed ID | |
| Domain | CDD:412411 |
| Functional Category | Others |
| Uniprot ID | P58528 |
| ORF Length (Amino Acid) | 95 |
| Conservation Analysis |
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1563993 | 1564280 | + | NC_014147.1 | Moraxella catarrhalis BBH18 |
| 2 | 369557 | 369844 | - | NZ_CP065728.1 | Moraxella nonliquefaciens |
| 3 | 2668045 | 2668332 | + | NZ_CP030241.1 | Moraxella bovis |
| 4 | 1806178 | 1806471 | + | NZ_CP011158.1 | Moraxella ovis |
| 5 | 1709685 | 1709978 | + | NZ_CP011381.2 | Moraxella bovoculi |
| 6 | 165776 | 166039 | + | NZ_LR134343.1 | Moraxella cuniculi |
| 7 | 690759 | 690998 | - | NZ_CP014945.1 | Psychrobacter alimentarius |
| 8 | 585933 | 586247 | - | NC_007969.1 | Psychrobacter cryohalolentis K5 |
| 9 | 588671 | 588985 | - | NC_007204.1 | Psychrobacter arcticus 273-4 |
| 10 | 897004 | 897243 | + | NZ_CP012678.1 | Psychrobacter urativorans |
| 11 | 1278182 | 1278415 | + | NZ_LR884459.1 | Psychrobacter arenosus |
| 12 | 1021411 | 1021653 | + | NZ_CP014234.1 | Moraxella osloensis |
| 13 | 2691507 | 2691746 | + | NZ_CP049801.1 | Acinetobacter shaoyimingii |
| 14 | 2760573 | 2760812 | + | NZ_CP032134.1 | Acinetobacter chinensis |
| Neighborhood Conservation Analysis |
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF10150.11 | 0.93 | 13 | 3602 | opposite-strand | Ribonuclease E/G family |
| 2 | PF02545.16 | 1.0 | 14 | 2888.0 | opposite-strand | Maf-like protein |
| 3 | PF01425.23 | 1.0 | 14 | 73.0 | same-strand | Amidase |
| 4 | PF02934.17 | 1.0 | 14 | 1634.5 | same-strand | GatB/GatE catalytic domain |
| 5 | PF02637.20 | 1.0 | 14 | 1634.5 | same-strand | GatB domain |
| 6 | PF06723.15 | 0.71 | 10 | 669.5 | opposite-strand | MreB/Mbl protein |
| 7 | PF14450.8 | 0.71 | 10 | 669.5 | opposite-strand | Cell division protein FtsA |
| 8 | PF04085.16 | 0.71 | 10 | 1867.0 | opposite-strand | rod shape-determining protein MreC |
| 9 | PF04093.14 | 0.71 | 10 | 2766.5 | opposite-strand | rod shape-determining protein MreD |