Result : P58236
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein ssr0761 |
| NCBI Accession ID | BA000022.2 |
| Organism | Synechocystis sp. (strain PCC 6803 / Kazusa) |
| Left | 2085826 |
| Right | 2086110 |
| Strand | + |
| Nucleotide Sequence | ATGGGGGAAACTTTGCCCCAACAATTGCCAAACATGAACGCAGTCAGCCAAATTATTGCACAACAAAAACTTGCAGCTATCATGGAGCAAGTATGTAGTGATCATGTTCCAACAATTATCACCAGGGATACCCAACCATCTGTCGTCATGATTTCCCTGGAAGACTATCAGTCATTAGAAGAAACAGCATATCTACTACGTAGCCCGAACAATGCTCAAAAATTGATGTCGGCGATCAAGCAATTAGAAAATGATCAAGGTGTCGAAAGGGAACTATTGGAGTGA |
| Sequence | MGETLPQQLPNMNAVSQIIAQQKLAAIMEQVCSDHVPTIITRDTQPSVVMISLEDYQSLEETAYLLRSPNNAQKLMSAIKQLENDQGVERELLE |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl09153. Profile Description: Antitoxin Phd_YefM, type II toxin-antitoxin system. This model recognizes a region of about 55 amino acids toward the N-terminal end of bacterial proteins of about 85 amino acids in length. The best-characterized member is prevent-host-death (phd) of bacteriophage P1, the antidote partner of death-on-curing (doc) (TIGR01550) in an addiction module. Addiction modules prevent plasmid curing by killing the host cell as the longer-lived killing protein persists while the gene for the shorter-lived antidote is lost. Note, however, that relatively few members of this family appear to be plasmid or phage-encoded. Also, there is little overlap, except for phage P1 itself, of species with this family and with the doc family. [Cellular processes, Toxin production and resistance, Mobile and extrachromosomal element functions, Other] |
| Pubmed ID | 8590279 8905231 |
| Domain | CDD:415595 |
| Functional Category | Others |
| Uniprot ID | P58236 |
| ORF Length (Amino Acid) | 94 |
++ More..
| Conservation Analysis |
No. of Species: 49
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 315423 | 315674 | - | NZ_CP043042.1 | Marinobacter fonticola |
| 2 | 1048646 | 1048897 | - | NZ_CP013341.1 | Nitrosomonas ureae |
| 3 | 3636616 | 3636867 | + | NZ_CP014476.1 | Methylomonas denitrificans |
| 4 | 1148528 | 1148779 | + | NZ_LS483250.1 | Moritella yayanosii |
| 5 | 2558462 | 2558716 | + | NZ_CP014226.1 | Halomonas chromatireducens |
| 6 | 1008053 | 1008304 | - | NZ_CP048602.1 | Halomonas piezotolerans |
| 7 | 339523 | 339774 | + | NC_016112.1 | Methylotuvimicrobium alcaliphilum 20Z |
| 8 | 1733443 | 1733694 | + | NZ_CP010311.1 | Geoalkalibacter subterraneus |
| 9 | 876172 | 876423 | - | NC_008789.1 | Halorhodospira halophila SL1 |
| 10 | 2596176 | 2596427 | + | NZ_CP043929.1 | Methylomonas rhizoryzae |
| 11 | 51819 | 52070 | + | NC_015942.1 | Acidithiobacillus ferrivorans SS3 |
| 12 | 2247908 | 2248159 | + | NZ_CP021358.1 | Kushneria marisflavi |
| 13 | 4912093 | 4912344 | + | NZ_CP059082.1 | Halomonas titanicae |
| 14 | 1472195 | 1472446 | - | NZ_CP018839.1 | Thauera chlorobenzoica |
| 15 | 2765368 | 2765619 | + | NZ_AP021875.1 | Desulfosarcina widdelii |
| 16 | 3060799 | 3061050 | + | NC_014315.1 | Nitrosococcus watsonii C-113 |
| 17 | 1682385 | 1682636 | + | NZ_CP017715.1 | Marinobacter salinus |
| 18 | 2905503 | 2905754 | - | NZ_LR778301.1 | Denitratisoma oestradiolicum |
| 19 | 56736 | 56987 | - | NZ_CP029211.1 | Aquabacterium olei |
| 20 | 399661 | 399912 | - | NC_013851.1 | Allochromatium vinosum DSM 180 |
| 21 | 2335974 | 2336225 | - | NC_007912.1 | Saccharophagus degradans 2-40 |
| 22 | 5761073 | 5761324 | - | NZ_AP021876.1 | Desulfosarcina ovata subsp. sediminis |
| 23 | 2060935 | 2061186 | - | NZ_AP018721.1 | Sulfuritortus calidifontis |
| 24 | 468764 | 469015 | - | NZ_CP031093.1 | Hydrocarboniclastica marina |
| 25 | 350096 | 350329 | + | NZ_CP072793.1 | Thiothrix unzii |
| 26 | 1051226 | 1051477 | - | NZ_CP021323.1 | Kushneria konosiri |
| 27 | 989850 | 990101 | - | NC_021291.1 | Spiribacter salinus M19-40 |
| 28 | 3312408 | 3312659 | + | NZ_CP028339.1 | Thauera aromatica K172 |
| 29 | 3914769 | 3915020 | - | NZ_CP061081.1 | Marinomonas arctica |
| 30 | 2206704 | 2206955 | - | NZ_AP017372.2 | Halorhodospira halochloris |
| 31 | 1772093 | 1772344 | + | NZ_CP020121.1 | Comamonas kerstersii |
| 32 | 566558 | 566809 | - | NZ_CP043575.1 | Comamonas koreensis |
| 33 | 1945211 | 1945462 | + | NZ_CP044399.1 | Moritella marina ATCC 15381 |
| 34 | 4492014 | 4492265 | - | NZ_CP036299.1 | Planctopirus ephydatiae |
| 35 | 2374702 | 2374953 | + | NZ_CP007029.1 | Thioalkalivibrio paradoxus ARh 1 |
| 36 | 758588 | 758839 | - | NZ_AP022843.1 | Halomonas hydrothermalis |
| 37 | 1133068 | 1133319 | + | NZ_CP035467.1 | Methylotuvimicrobium buryatense |
| 38 | 2228585 | 2228836 | - | NC_011146.1 | Citrifermentans bemidjiense Bem |
| 39 | 938451 | 938702 | - | NC_017857.3 | Methylophaga nitratireducenticrescens |
| 40 | 172409 | 172660 | + | NZ_CP025682.1 | Azoarcus pumilus |
| 41 | 2234893 | 2235144 | + | NZ_CP016878.1 | Xanthomonas hortorum |
| 42 | 3385520 | 3385771 | - | NZ_CP043476.1 | Xanthomonas hyacinthi |
| 43 | 770567 | 770818 | + | NC_004757.1 | Nitrosomonas europaea ATCC 19718 |
| 44 | 1990045 | 1990305 | + | NZ_CP007139.1 | Fimbriimonas ginsengisoli Gsoil 348 |
| 45 | 1280311 | 1280562 | - | NZ_CP028127.1 | Xanthomonas vasicola pv. vasculorum |
| 46 | 27441 | 27692 | - | NZ_CP038855.1 | Pantoea vagans |
| 47 | 4170067 | 4170318 | - | NC_008781.1 | Polaromonas naphthalenivorans CJ2 |
| 48 | 1320039 | 1320293 | - | NZ_CP059564.1 | Alysiella filiformis |
| 49 | 1300588 | 1300839 | - | NZ_AP018795.1 | Acidithiobacillus ferridurans |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP043042.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF06769.16 | 0.96 | 47 | -3.0 | same-strand | YoeB-like toxin of bacterial type II toxin-antitoxin system |
++ More..