Result : P58094
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YciX |
| NCBI Accession ID | U00096.3 |
| Organism | Escherichia coli (strain K12) |
| Left | 1335291 |
| Right | 1335458 |
| Strand | + |
| Nucleotide Sequence | ATGGTCGGTCAGGAGCAACTGGAGTCGTCACCATTATGCCAGCATAGTGACAATGAAACAGAAACGAAACGGGAATGTTCCGTCGTTATTCCAGACGACTGGCAACTAACATCGCAGCAGCAAGCCTTTATAGAACTGTTTGCTGAAGATGATCAGCCGAAACAATAA |
| Sequence | MVGQEQLESSPLCQHSDNETETKRECSVVIPDDWQLTSQQQAFIELFAEDDQPKQ |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 9278503 16738553 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | P58094 |
| ORF Length (Amino Acid) | 55 |
++ More..
| Conservation Analysis |
No. of Species: 9
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1335291 | 1335458 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 2 | 1329575 | 1329742 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 3 | 1836135 | 1836302 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 4 | 2403025 | 2403195 | - | NZ_LR134340.1 | Escherichia marmotae |
| 5 | 2547225 | 2547359 | - | NZ_CP017184.1 | Enterobacter roggenkampii |
| 6 | 4677565 | 4677699 | + | NZ_CP025034.2 | Enterobacter sp. SGAir0187 |
| 7 | 2805538 | 2805672 | - | NZ_CP043318.1 | Enterobacter chengduensis |
| 8 | 1320471 | 1320641 | + | NC_009792.1 | Citrobacter koseri ATCC BAA-895 |
| 9 | 2584150 | 2584284 | - | NZ_CP027986.1 | Enterobacter sichuanensis |
| 10 | 3992069 | 3992242 | - | NZ_LT556085.1 | Citrobacter amalonaticus |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_002695.2
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF08496.12 | 1.0 | 9 | 4956.5 | same-strand | Peptidase family S49 N-terminal |
| 2 | PF01343.20 | 1.0 | 9 | 4956.5 | same-strand | Peptidase family S49 |
| 3 | PF10692.11 | 1.0 | 9 | 4651.5 | opposite-strand | Protein of unknown function (DUF2498) |
| 4 | PF01131.22 | 1.0 | 9 | 1656.0 | same-strand | DNA topoisomerase |
| 5 | PF08272.13 | 1.0 | 9 | 1656.0 | same-strand | Topoisomerase I zinc-ribbon-like |
| 6 | PF01751.24 | 1.0 | 9 | 1656.0 | same-strand | Toprim domain |
| 7 | PF01396.21 | 1.0 | 9 | 1656.0 | same-strand | Topoisomerase DNA binding C4 zinc finger |
| 8 | PF03466.22 | 1.0 | 9 | 467.0 | same-strand | LysR substrate binding domain |
| 9 | PF00126.29 | 1.0 | 9 | 467.0 | same-strand | Bacterial regulatory helix-turn-helix protein, lysR family |
| 10 | PF00330.22 | 1.0 | 9 | 398.0 | same-strand | Aconitase family (aconitate hydratase) |
| 11 | PF00694.21 | 1.0 | 9 | 398.0 | same-strand | Aconitase C-terminal domain |
| 12 | PF00925.22 | 1.0 | 9 | 3112.0 | opposite-strand | GTP cyclohydrolase II |
| 13 | PF01569.23 | 1.0 | 9 | 3897.0 | same-strand | PAP2 superfamily |
| 14 | PF06305.13 | 1.0 | 9 | 4813.0 | same-strand | Lipopolysaccharide assembly protein A domain |
| 15 | PF14559.8 | 0.67 | 6 | 5128.0 | same-strand | Tetratricopeptide repeat |
| 16 | PF18073.3 | 0.78 | 7 | 5128 | same-strand | Rubredoxin metal binding domain |
| 17 | PF13424.8 | 0.67 | 6 | 5139.0 | same-strand | Tetratricopeptide repeat |
++ More..