Result : P58092
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Antitoxin ParD |
| NCBI Accession ID | AE005174.2 |
| Organism | Escherichia coli O157:H7 |
| Left | 494258 |
| Right | 494500 |
| Strand | + |
| Nucleotide Sequence | ATGCGCAAAATTACCTCAGTAAGCGTTGGCGAACAATTAGATAGTTTTATTACCCGGATGGTCCAGTCTGGTCGTTATGGCTCGGCCAGTGAAGTAATGCGTTCGGCACTTCGTCTATTGGAACAACAAGAATCCAGGGATGAAGCTGTCAGAAATGCTGTTATTGAAGGTCTTGAGAGCGGTGAAAGTTCGATGACGCTTCGTGATATCGCAGCAGAAAGGAAGCAAAAACATCGTGTATAA |
| Sequence | MRKITSVSVGEQLDSFITRMVQSGRYGSASEVMRSALRLLEQQESRDEAVRNAVIEGLESGESSMTLRDIAAERKQKHRV |
| Source of smORF | Swiss-Prot |
| Function | Antitoxin component of a type II toxin-antitoxin (TA) system. Neutralizes the effect of toxin ParE (By similarity). {ECO:0000250}. |
| Pubmed ID | 11206551 11258796 |
| Domain | CDD:419885,CDD:425357 |
| Functional Category | Antitoxin_type_2 |
| Uniprot ID | P58092 |
| ORF Length (Amino Acid) | 80 |
++ More..
| Conservation Analysis |
No. of Species: 24
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 494257 | 494499 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 2 | 2315 | 2557 | - | NZ_CP009126.1 | Pectobacterium atrosepticum |
| 3 | 439302 | 439544 | - | NZ_FO704550.1 | Xenorhabdus doucetiae |
| 4 | 5562358 | 5562600 | + | NC_005126.1 | Photorhabdus laumondii subsp. laumondii TTO1 |
| 5 | 2819916 | 2820158 | + | NZ_CP040428.1 | Jejubacter calystegiae |
| 6 | 2429275 | 2429517 | + | NZ_LS483470.1 | Leminorella richardii |
| 7 | 283504 | 283746 | - | NZ_CP071766.1 | Acinetobacter towneri |
| 8 | 141100 | 141342 | - | NZ_CP051652.1 | Pectobacterium carotovorum |
| 9 | 2416632 | 2416874 | + | NZ_AP018685.1 | Vibrio rumoiensis |
| 10 | 134047 | 134289 | - | NZ_CP038498.1 | Pectobacterium punjabense |
| 11 | 3922272 | 3922514 | + | NZ_CP015749.1 | Pectobacterium parmentieri |
| 12 | 4338789 | 4339031 | + | NC_012962.1 | Photorhabdus asymbiotica |
| 13 | 4499296 | 4499538 | + | NZ_CP054058.1 | Scandinavium goeteborgense |
| 14 | 2998519 | 2998761 | - | NZ_FO704551.1 | Xenorhabdus poinarii G6 |
| 15 | 1413571 | 1413813 | + | NZ_CP029736.1 | Providencia rettgeri |
| 16 | 1427 | 1669 | - | NZ_CP040989.1 | Vibrio furnissii |
| 17 | 699073 | 699315 | + | NZ_CP034752.1 | Jinshanibacter zhutongyuii |
| 18 | 480685 | 480927 | + | NZ_CP035689.1 | Vibrio metoecus |
| 19 | 347919 | 348161 | - | NZ_AP014525.1 | Vibrio cholerae MS6 |
| 20 | 628934 | 629176 | + | NZ_CP008849.1 | Alteromonas australica |
| 21 | 483470 | 483712 | - | NZ_CP061081.1 | Marinomonas arctica |
| 22 | 2659286 | 2659531 | - | NZ_CP014056.2 | Grimontia hollisae |
| 23 | 826535 | 826777 | - | NZ_CP023536.1 | Providencia alcalifaciens |
| 24 | 1457067 | 1457321 | - | NZ_CP022111.1 | Nitrospirillum amazonense CBAmc |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_002695.2
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF05016.17 | 0.92 | 22 | -7 | same-strand | ParE toxin of type II toxin-antitoxin system, parDE |
++ More..