Result : A5ILC5
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 50S ribosomal protein L31 |
| NCBI Accession ID | CP000702.1 |
| Organism | Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) |
| Left | 1012759 |
| Right | 1012974 |
| Strand | + |
| Nucleotide Sequence | GTGAAAAAGGGAATACATCCAGAGATGAAGCTCGTAACTGTTAAGTGTGCGTGTGGTGCTGAGCACACTTTTTACACGACGGTTGACAATATAAGAATCGACGTGTGTTCTAACTGCCATCCGTTCTACACCTCCGGTGGAAAAGGTGGCGTTCTCATAGTGGATACGGAGGGTAGAGTGGAGAAGTTCAGAAGGAAGTACGGAGACAACTATTGA |
| Sequence | MKKGIHPEMKLVTVKCACGAEHTFYTTVDNIRIDVCSNCHPFYTSGGKGGVLIVDTEGRVEKFRRKYGDNY |
| Source of smORF | Swiss-Prot |
| Function | Binds the 23S rRNA. {ECO:0000255|HAMAP-Rule:MF_00501}. |
| Pubmed ID | |
| Domain | CDD:412343 |
| Functional Category | Metal-binding_and_Ribosomal_protein |
| Uniprot ID | A5ILC5 |
| ORF Length (Amino Acid) | 71 |
++ More..
| Conservation Analysis |
No. of Species: 271
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1012759 | 1012974 | + | NC_009486.1 | Thermotoga petrophila RKU-1 |
| 2 | 1149929 | 1150144 | - | NC_023151.1 | Thermotoga maritima MSB8 |
| 3 | 1156740 | 1156955 | - | NC_013642.1 | Thermotoga naphthophila RKU-10 |
| 4 | 870099 | 870314 | + | NC_011978.1 | Thermotoga neapolitana DSM 4359 |
| 5 | 253807 | 254016 | + | NZ_LS974202.1 | Mesotoga infera |
| 6 | 272337 | 272546 | - | NC_012785.1 | Kosmotoga olearia TBF 19.5.1 |
| 7 | 1693404 | 1693619 | + | NC_009828.1 | Pseudothermotoga lettingae TMO |
| 8 | 1728459 | 1728674 | + | NC_022792.1 | Pseudothermotoga elfii DSM 9442 = NBRC 107921 |
| 9 | 1187236 | 1187445 | + | NZ_CP007389.1 | Thermosipho melanesiensis |
| 10 | 2032886 | 2033095 | - | NZ_CP011232.1 | Kosmotoga pacifica |
| 11 | 1559354 | 1559563 | + | NC_011653.1 | Thermosipho africanus TCF52B |
| 12 | 833842 | 834051 | - | NC_017934.1 | Mesotoga prima MesG1.Ag.4.2 |
| 13 | 1511104 | 1511319 | + | NZ_AP014509.1 | Thermotoga caldifontis AZM44c09 |
| 14 | 1552652 | 1552867 | - | NC_022795.1 | Pseudothermotoga hypogea DSM 11164 = NBRC 106472 |
| 15 | 59911 | 60126 | - | NC_015707.1 | Pseudothermotoga thermarum DSM 5069 |
| 16 | 1984162 | 1984377 | - | NC_010003.1 | Petrotoga mobilis SJ95 |
| 17 | 1275355 | 1275570 | + | NZ_AP014510.1 | Thermotoga profunda AZM34c06 |
| 18 | 121232 | 121453 | + | NZ_LN824141.1 | Defluviitoga tunisiensis |
| 19 | 776511 | 776726 | - | NZ_AP018712.1 | Tepiditoga spiralis |
| 20 | 1808323 | 1808538 | - | NC_016751.1 | Marinitoga piezophila KA3 |
| 21 | 172743 | 172955 | - | NC_009718.1 | Fervidobacterium nodosum Rt17-B1 |
| 22 | 500670 | 500882 | - | NZ_CP014334.1 | Fervidobacterium islandicum |
| 23 | 434278 | 434490 | - | NC_017095.1 | Fervidobacterium pennivorans DSM 9078 |
| 24 | 1271746 | 1271961 | + | NC_015318.1 | Hippea maritima DSM 10411 |
| 25 | 2136929 | 2137129 | - | NZ_AP022873.1 | Dissulfurispira thermophila |
| 26 | 797629 | 797829 | + | NZ_CP018099.1 | Caldithrix abyssi DSM 13497 |
| 27 | 739119 | 739358 | + | NC_014011.1 | Aminobacterium colombiense DSM 12261 |
| 28 | 151795 | 151998 | - | NZ_CP042652.1 | Pseudoarcobacter acticola |
| 29 | 580771 | 581001 | - | NC_015681.1 | Thermodesulfatator indicus DSM 15286 |
| 30 | 2062753 | 2062968 | + | NZ_AP022345.1 | Fluviibacter phosphoraccumulans |
| 31 | 3924114 | 3924314 | - | NZ_LS483476.1 | Lederbergia lentus |
| 32 | 2607271 | 2607471 | - | NZ_CP034118.1 | Staphylospora marina |
| 33 | 773048 | 773263 | - | NZ_CP038452.1 | Thermus caldilimi |
| 34 | 236955 | 237170 | + | NZ_CP040021.1 | Salinivibrio kushneri |
| 35 | 2608587 | 2608793 | - | NZ_CP016379.1 | Anoxybacter fermentans |
| 36 | 545223 | 545444 | - | NZ_CP042909.1 | Thermosulfurimonas marina |
| 37 | 109173 | 109391 | + | NC_013939.1 | Deferribacter desulfuricans SSM1 |
| 38 | 3886575 | 3886778 | + | NZ_AP014936.1 | Sulfurifustis variabilis |
| 39 | 302010 | 302222 | + | NC_014758.1 | Calditerrivibrio nitroreducens DSM 19672 |
| 40 | 250819 | 251043 | - | NC_015682.1 | Thermodesulfobacterium geofontis OPF15 |
| 41 | 78240 | 78440 | + | NC_019940.1 | Thioflavicoccus mobilis 8321 |
| 42 | 775254 | 775460 | + | NZ_CP011801.1 | Nitrospira moscoviensis |
| 43 | 119369 | 119572 | - | NZ_CP032100.1 | Arcobacter suis CECT 7833 |
| 44 | 143476 | 143679 | - | NZ_CP053835.1 | Arcobacter defluvii |
| 45 | 139415 | 139618 | - | NZ_CP053840.1 | Arcobacter venerupis |
| 46 | 422469 | 422669 | + | NC_007517.1 | Geobacter metallireducens GS-15 |
| 47 | 123050 | 123253 | - | NZ_CP032097.1 | Arcobacter ellisii |
| 48 | 55786 | 55989 | - | NZ_CP036246.2 | [Arcobacter] porcinus |
| 49 | 2729628 | 2729831 | - | NC_008346.1 | Syntrophomonas wolfei subsp. wolfei str. Goettingen G311 |
| 50 | 1896747 | 1896953 | + | NZ_LT828648.1 | Nitrospira japonica |
| 51 | 191353 | 191553 | - | NZ_CP053836.1 | Halarcobacter ebronensis |
| 52 | 738095 | 738295 | + | NZ_CP016622.1 | Parageobacillus thermoglucosidasius |
| 53 | 54487 | 54687 | + | NC_013385.1 | Ammonifex degensii KC4 |
| 54 | 309421 | 309621 | + | NZ_CP012196.1 | Campylobacter gracilis |
| 55 | 1797417 | 1797620 | + | NZ_AP019551.1 | Athalassotoga saccharophila |
| 56 | 147889 | 148092 | + | NC_017187.1 | Aliarcobacter butzleri ED-1 |
| 57 | 1476032 | 1476247 | - | NC_022538.1 | Acholeplasma palmae J233 |
| 58 | 821710 | 821916 | + | NC_011661.1 | Dictyoglomus turgidum DSM 6724 |
| 59 | 649777 | 649983 | + | NC_011297.1 | Dictyoglomus thermophilum H-6-12 |
| 60 | 2634340 | 2634543 | - | NZ_AP024085.1 | Faecalibacillus intestinalis |
| 61 | 2092875 | 2093105 | + | NC_008554.1 | Syntrophobacter fumaroxidans MPOB |
| 62 | 115693 | 115896 | - | NZ_CP031218.1 | Malaciobacter halophilus |
| 63 | 118195 | 118398 | - | NZ_CP042812.1 | Malaciobacter canalis |
| 64 | 116895 | 117098 | - | NZ_CP032101.1 | Malaciobacter marinus |
| 65 | 1605191 | 1605391 | - | NZ_AP022847.1 | Nitrosophilus alvini |
| 66 | 217135 | 217341 | + | NZ_LT635475.1 | Ezakiella massiliensis |
| 67 | 106761 | 106964 | - | NZ_CP031219.1 | Malaciobacter mytili LMG 24559 |
| 68 | 3220972 | 3221172 | - | NZ_CP012024.1 | Bacillus smithii |
| 69 | 398699 | 398899 | + | NZ_CP018058.1 | Geobacillus thermocatenulatus |
| 70 | 1371347 | 1371547 | - | NZ_CP007774.1 | Campylobacter volucris LMG 24379 |
| 71 | 1548968 | 1549189 | - | NZ_CP019959.1 | Vibrio owensii |
| 72 | 2581312 | 2581512 | - | NZ_CP061470.1 | Geobacillus zalihae |
| 73 | 78283 | 78486 | - | NZ_CP030944.1 | Arcobacter aquimarinus |
| 74 | 600974 | 601192 | - | NZ_CP019400.1 | Acidipropionibacterium acidipropionici |
| 75 | 317030 | 317233 | + | NC_002977.6 | Methylococcus capsulatus str. Bath |
| 76 | 161203 | 161403 | + | NZ_CP053841.1 | Campylobacter blaseri |
| 77 | 2994656 | 2994856 | - | NZ_CP064060.1 | Anoxybacillus caldiproteolyticus |
| 78 | 2942565 | 2942777 | - | NZ_LN681225.1 | Legionella hackeliae |
| 79 | 3419559 | 3419759 | - | NC_006510.1 | Geobacillus kaustophilus HTA426 |
| 80 | 2520105 | 2520305 | + | NZ_CP061472.1 | Geobacillus thermoleovorans |
| 81 | 125567 | 125767 | + | NZ_CP016020.1 | Bacillus weihaiensis |
| 82 | 2034970 | 2035176 | + | NC_018178.1 | Melioribacter roseus P3M-2 |
| 83 | 203019 | 203237 | + | NZ_AP018689.1 | Vibrio aphrogenes |
| 84 | 214010 | 214213 | - | NZ_AP018721.1 | Sulfuritortus calidifontis |
| 85 | 2007519 | 2007719 | - | NZ_CP009709.1 | Weizmannia coagulans DSM 1 = ATCC 7050 |
| 86 | 1440426 | 1440626 | - | NZ_CP053825.1 | Campylobacter armoricus |
| 87 | 1485495 | 1485695 | - | NZ_CP053848.1 | Campylobacter ornithocola |
| 88 | 484923 | 485123 | - | NZ_CP063079.1 | Campylobacter peloridis |
| 89 | 2562518 | 2562733 | + | NZ_CP022741.1 | Vibrio qinghaiensis |
| 90 | 1321513 | 1321713 | - | NZ_CP007770.1 | Campylobacter insulaenigrae NCTC 12927 |
| 91 | 517974 | 518186 | - | NZ_AP018558.1 | Hydrogenophilus thermoluteolus |
| 92 | 1007073 | 1007285 | - | NZ_AP019755.1 | Nitrosomonas stercoris |
| 93 | 158139 | 158339 | - | NC_002163.1 | Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819 |
| 94 | 78797 | 79000 | - | NZ_CP053833.1 | Arcobacter cloacae |
| 95 | 1924311 | 1924517 | - | NC_011899.1 | Halothermothrix orenii H 168 |
| 96 | 260401 | 260601 | + | NZ_CP059443.1 | Campylobacter fetus |
| 97 | 3913377 | 3913586 | - | NC_011898.1 | Ruminiclostridium cellulolyticum H10 |
| 98 | 275069 | 275287 | + | NZ_CP030788.1 | Vibrio campbellii |
| 99 | 465577 | 465777 | + | NZ_CP035130.1 | Gudongella oleilytica |
| 100 | 2250700 | 2250909 | - | NZ_CP025120.1 | Kangiella profundi |
| 101 | 3802125 | 3802328 | - | NZ_CP023704.1 | Caldibacillus thermoamylovorans |
| 102 | 622036 | 622239 | + | NZ_AP017470.1 | Thermotomaculum hydrothermale |
| 103 | 2170762 | 2170986 | - | NC_017455.1 | Halanaerobium praevalens DSM 2228 |
| 104 | 1124143 | 1124367 | + | NC_004757.1 | Nitrosomonas europaea ATCC 19718 |
| 105 | 2086914 | 2087144 | - | NC_015672.1 | Flexistipes sinusarabici DSM 4947 |
| 106 | 2306371 | 2306592 | - | NZ_CP059569.1 | Kingella oralis |
| 107 | 1119534 | 1119740 | + | NZ_CP006950.1 | Dehalococcoides mccartyi CG4 |
| 108 | 1716630 | 1716848 | + | NZ_CP065150.1 | Vibrio kanaloae |
| 109 | 3057357 | 3057578 | - | NZ_CP044069.1 | Vibrio vulnificus |
| 110 | 1757287 | 1757490 | - | NZ_AP019711.1 | Amedibacterium intestinale |
| 111 | 585451 | 585651 | + | NZ_CP070511.1 | Parageobacillus toebii |
| 112 | 3410590 | 3410787 | - | NC_002939.5 | Geobacter sulfurreducens PCA |
| 113 | 1442017 | 1442217 | - | NZ_CP020478.1 | Campylobacter helveticus |
| 114 | 288246 | 288446 | + | NZ_CP010995.1 | Campylobacter iguaniorum |
| 115 | 216301 | 216501 | + | NZ_CP020867.1 | Campylobacter cuniculorum DSM 23162 = LMG 24588 |
| 116 | 1046546 | 1046758 | - | NZ_CP014056.2 | Grimontia hollisae |
| 117 | 2827670 | 2827888 | - | NZ_CP018312.1 | Vibrio rotiferianus |
| 118 | 1961458 | 1961676 | - | NZ_CP025792.1 | Vibrio jasicida 090810c |
| 119 | 271995 | 272204 | + | NZ_CP036150.1 | Oceanispirochaeta crateris |
| 120 | 1671901 | 1672101 | - | NZ_CP007773.1 | Campylobacter subantarcticus LMG 24377 |
| 121 | 512083 | 512301 | + | NZ_CP016397.1 | Legionella clemsonensis |
| 122 | 120948 | 121148 | - | NZ_CP031217.1 | Halarcobacter bivalviorum |
| 123 | 1828725 | 1828925 | - | NZ_CP035946.1 | Campylobacter canadensis |
| 124 | 2660848 | 2661048 | - | NZ_CP012152.1 | Anoxybacillus gonensis |
| 125 | 1756846 | 1757049 | + | NZ_AP023212.1 | Hydrogenimonas urashimensis |
| 126 | 2608423 | 2608635 | + | NC_008344.1 | Nitrosomonas eutropha C91 |
| 127 | 457385 | 457621 | + | NZ_LR699114.1 | Aquicella lusitana |
| 128 | 108539 | 108739 | - | NZ_CP035928.1 | Malaciobacter pacificus |
| 129 | 246318 | 246518 | + | NZ_CP015578.1 | Campylobacter lanienae NCTC 13004 |
| 130 | 4109335 | 4109547 | + | NZ_CP044399.1 | Moritella marina ATCC 15381 |
| 131 | 2444927 | 2445142 | + | NZ_CP023559.1 | Salinicola tamaricis |
| 132 | 2091876 | 2092094 | - | NZ_CP046793.1 | Vibrio metschnikovii |
| 133 | 5723194 | 5723397 | + | NZ_AP017928.1 | Methylocaldum marinum |
| 134 | 241180 | 241398 | + | NZ_CP039700.1 | Vibrio cyclitrophicus |
| 135 | 1914659 | 1914880 | - | NZ_CP048877.1 | Thermosulfuriphilus ammonigenes |
| 136 | 223483 | 223683 | - | NZ_CP012544.1 | Campylobacter showae |
| 137 | 237690 | 237908 | + | NZ_AP018685.1 | Vibrio rumoiensis |
| 138 | 645222 | 645437 | + | NZ_CP044427.1 | Ornithinimicrobium pratense |
| 139 | 1876431 | 1876631 | - | NZ_CP017705.1 | Brevibacillus laterosporus DSM 25 |
| 140 | 1364026 | 1364226 | - | NC_012039.1 | Campylobacter lari RM2100 |
| 141 | 1870088 | 1870300 | + | NZ_CP018804.1 | Histophilus somni |
| 142 | 2536803 | 2537015 | - | NZ_CP035108.1 | Geovibrio thiophilus |
| 143 | 3250106 | 3250306 | - | NZ_CP011971.1 | Steroidobacter denitrificans |
| 144 | 841346 | 841546 | - | NZ_CP017703.1 | Aeribacillus pallidus |
| 145 | 781775 | 781978 | - | NZ_AP022853.1 | Sulfurimicrobium lacus |
| 146 | 2245450 | 2245650 | + | NZ_CP012543.1 | Campylobacter rectus |
| 147 | 1958555 | 1958755 | - | NZ_CP063164.1 | Sulfurovum indicum |
| 148 | 3370789 | 3370992 | - | NZ_AP021884.1 | Sulfuriferula plumbiphila |
| 149 | 3008328 | 3008558 | - | NC_013861.1 | Legionella longbeachae NSW150 |
| 150 | 209933 | 210133 | + | NZ_CP017111.1 | Sulfurospirillum halorespirans DSM 13726 |
| 151 | 214878 | 215078 | + | NZ_CP007201.1 | Sulfurospirillum multivorans DSM 12446 |
| 152 | 2846651 | 2846857 | - | NZ_AP018724.1 | Sulfurivermis fontis |
| 153 | 2791913 | 2792116 | + | NZ_AP014879.1 | Sulfuricaulis limicola |
| 154 | 2577071 | 2577295 | - | NC_010572.1 | Streptomyces griseus subsp. griseus NBRC 13350 |
| 155 | 209300 | 209515 | + | NZ_CP012621.1 | Zobellella denitrificans |
| 156 | 103778 | 103978 | + | NZ_CP053831.1 | Campylobacter mucosalis |
| 157 | 153309 | 153509 | + | NC_013512.1 | Sulfurospirillum deleyianum DSM 6946 |
| 158 | 1972901 | 1973113 | + | NZ_CP008802.1 | Actinotignum schaalii |
| 159 | 3802585 | 3802785 | - | NC_016112.1 | Methylotuvimicrobium alcaliphilum 20Z |
| 160 | 2970934 | 2971152 | + | NC_011312.1 | Aliivibrio salmonicida LFI1238 |
| 161 | 2476427 | 2476645 | - | NZ_CP018839.1 | Thauera chlorobenzoica |
| 162 | 4749496 | 4749711 | + | NZ_CP017707.1 | Chromobacterium vaccinii |
| 163 | 167011 | 167211 | + | NC_018002.1 | Sulfurospirillum barnesii SES-3 |
| 164 | 3253272 | 3253478 | - | NC_014624.2 | Eubacterium callanderi |
| 165 | 4116971 | 4117177 | + | NZ_CP029487.1 | Eubacterium maltosivorans |
| 166 | 1929519 | 1929725 | + | NZ_CP019962.1 | Eubacterium limosum |
| 167 | 1304611 | 1304823 | + | NZ_CP015425.1 | [Haemophilus] ducreyi |
| 168 | 199753 | 199953 | + | NZ_CP053826.1 | Campylobacter curvus |
| 169 | 1561061 | 1561279 | - | NZ_CP028339.1 | Thauera aromatica K172 |
| 170 | 1084377 | 1084577 | + | NZ_CP031611.1 | Campylobacter hepaticus |
| 171 | 2570557 | 2570757 | - | NZ_AP014724.1 | Sulfurospirillum cavolei |
| 172 | 1825806 | 1826012 | - | NZ_CP015519.1 | Syntrophotalea acetylenivorans |
| 173 | 15184 | 15423 | + | NZ_AP022603.1 | Mycolicibacterium fallax |
| 174 | 4152746 | 4152985 | + | NZ_AP022603.1 | Mycolicibacterium fallax |
| 175 | 2322136 | 2322354 | + | NZ_CP025682.1 | Azoarcus pumilus |
| 176 | 1278320 | 1278535 | + | NZ_AP019312.1 | Chromobacterium haemolyticum |
| 177 | 1446385 | 1446612 | - | NZ_CP033972.1 | Gordonia insulae |
| 178 | 12572431 | 12572637 | + | NC_010162.1 | Sorangium cellulosum So ce56 |
| 179 | 2379376 | 2379603 | + | NC_007614.1 | Nitrosospira multiformis ATCC 25196 |
| 180 | 5729993 | 5730217 | + | NZ_CP020570.1 | Streptomyces violaceoruber |
| 181 | 354297 | 354500 | + | NZ_AP019309.1 | Intestinibaculum porci |
| 182 | 983999 | 984217 | - | NC_009664.2 | Kineococcus radiotolerans SRS30216 = ATCC BAA-149 |
| 183 | 5557385 | 5557609 | + | NZ_CP013738.1 | Streptomyces globisporus C-1027 |
| 184 | 2513065 | 2513286 | - | NZ_CP011391.1 | Faecalibaculum rodentium |
| 185 | 1135093 | 1135305 | + | NZ_LR134327.1 | Aggregatibacter aphrophilus ATCC 33389 |
| 186 | 220665 | 220868 | - | NC_019902.2 | Thioalkalivibrio nitratireducens DSM 14787 |
| 187 | 2233108 | 2233317 | + | NC_008593.1 | Clostridium novyi NT |
| 188 | 894955 | 895155 | + | NZ_CP035467.1 | Methylotuvimicrobium buryatense |
| 189 | 1895461 | 1895673 | - | NZ_CP066802.1 | Actinomyces weissii |
| 190 | 749751 | 749963 | - | NZ_CP066049.1 | Actinomyces naeslundii |
| 191 | 306336 | 306554 | - | NZ_CP030103.1 | Mycoplasma cloacale |
| 192 | 364457 | 364660 | - | NZ_CP018632.1 | Granulosicoccus antarcticus IMCC3135 |
| 193 | 5673811 | 5674035 | + | NZ_CP070242.1 | Streptomyces californicus |
| 194 | 1323024 | 1323233 | - | NZ_AP012547.1 | Sulfuritalea hydrogenivorans sk43H |
| 195 | 1302372 | 1302584 | - | NZ_CP034438.1 | Flaviflexus salsibiostraticola |
| 196 | 4411494 | 4411718 | + | NZ_CP009922.3 | Streptomyces xiamenensis |
| 197 | 2535812 | 2536024 | - | NZ_LT906451.1 | Legionella lansingensis |
| 198 | 304937 | 305137 | + | NC_015572.1 | Methylomonas methanica MC09 |
| 199 | 21010 | 21225 | - | NZ_CP015031.1 | Basfia succiniciproducens |
| 200 | 416249 | 416464 | - | NC_006300.1 | [Mannheimia] succiniciproducens MBEL55E |
| 201 | 1829448 | 1829648 | - | NC_014935.1 | Nitratifractor salsuginis DSM 16511 |
| 202 | 2947317 | 2947541 | + | NZ_CP021106.3 | Nitrosospira lacus |
| 203 | 2315056 | 2315271 | + | NZ_CP022579.1 | Oryzomicrobium terrae |
| 204 | 1596077 | 1596289 | - | NZ_LR134477.1 | Actinomyces viscosus |
| 205 | 3131743 | 3131943 | + | NC_018012.1 | Thiocystis violascens DSM 198 |
| 206 | 1394761 | 1394976 | - | NZ_CP014989.1 | Serinicoccus hydrothermalis |
| 207 | 1358223 | 1358435 | - | NZ_CP029206.1 | Actinobacillus porcitonsillarum |
| 208 | 2015793 | 2016008 | - | NZ_CP041091.1 | Nocardioides sambongensis |
| 209 | 2079457 | 2079669 | - | NZ_CP025227.1 | Actinomyces wuliandei |
| 210 | 1447200 | 1447436 | + | NZ_CP016757.1 | Cloacibacillus porcorum |
| 211 | 2009634 | 2009861 | + | NC_013441.1 | Gordonia bronchialis DSM 43247 |
| 212 | 529287 | 529499 | + | NZ_CP066060.1 | Actinomyces oris |
| 213 | 277860 | 278072 | - | NZ_CP013019.1 | Clostridium pasteurianum |
| 214 | 1879168 | 1879380 | - | NZ_CP053642.1 | Actinomyces marmotae |
| 215 | 409802 | 410014 | + | NZ_CP070228.1 | Arcanobacterium phocisimile |
| 216 | 2471234 | 2471443 | - | NZ_CP012373.2 | Beggiatoa leptomitoformis |
| 217 | 2621809 | 2622033 | - | NZ_CP012371.1 | Nitrosospira briensis C-128 |
| 218 | 1037491 | 1037700 | + | NC_021064.1 | Cutibacterium avidum 44067 |
| 219 | 908247 | 908459 | + | NZ_CP051884.1 | Cellulomonas taurus |
| 220 | 3996907 | 3997131 | - | NZ_CP016268.1 | Woeseia oceani |
| 221 | 2958441 | 2958653 | + | NZ_LR134350.1 | Actinomyces howellii |
| 222 | 738310 | 738513 | - | NC_022357.1 | Sulfuricella denitrificans skB26 |
| 223 | 1646310 | 1646522 | + | NZ_CP027433.1 | Gordonia iterans |
| 224 | 1090023 | 1090232 | - | NZ_CP010554.1 | Rugosibacter aromaticivorans |
| 225 | 353459 | 353671 | + | NZ_LR134357.1 | Actinomyces israelii |
| 226 | 4812771 | 4812998 | - | NZ_CP015163.1 | Amycolatopsis albispora |
| 227 | 2821144 | 2821359 | - | NZ_CP039291.1 | Cellulomonas shaoxiangyii |
| 228 | 823712 | 823912 | - | NZ_CP043929.1 | Methylomonas rhizoryzae |
| 229 | 3434711 | 3434911 | + | NC_013851.1 | Allochromatium vinosum DSM 180 |
| 230 | 2890235 | 2890447 | - | NZ_LS483250.1 | Moritella yayanosii |
| 231 | 226860 | 227072 | + | NZ_CP009610.1 | Haemophilus influenzae |
| 232 | 667187 | 667399 | - | NZ_LS483458.1 | Haemophilus haemolyticus |
| 233 | 270948 | 271160 | + | NZ_LS483429.1 | Haemophilus aegyptius |
| 234 | 281626 | 281838 | - | NZ_LT906463.1 | Haemophilus pittmaniae |
| 235 | 2126486 | 2126698 | - | NZ_CP040863.1 | Rodentibacter heylii |
| 236 | 5063721 | 5063942 | + | NZ_CP040752.1 | Streptomyces rectiverticillatus |
| 237 | 1227830 | 1228042 | + | NZ_CP039292.1 | Actinomyces procaprae |
| 238 | 27664 | 27876 | - | NZ_LR134424.1 | Legionella adelaidensis |
| 239 | 679551 | 679757 | - | NZ_AP019307.1 | Nocardioides baekrokdamisoli |
| 240 | 2607949 | 2608149 | + | NZ_CP039268.1 | Thermochromatium tepidum ATCC 43061 |
| 241 | 245710 | 245931 | + | NZ_LT635457.1 | Actinomyces pacaensis |
| 242 | 407159 | 407383 | - | NC_011027.1 | Chlorobaculum parvum NCIB 8327 |
| 243 | 1375482 | 1375706 | - | NZ_LT593929.1 | Propionibacterium freudenreichii |
| 244 | 3064214 | 3064417 | - | NZ_CP013341.1 | Nitrosomonas ureae |
| 245 | 2904911 | 2905123 | - | NZ_LR134363.1 | Actinomyces slackii |
| 246 | 3020862 | 3021074 | + | NC_015687.1 | Clostridium acetobutylicum DSM 1731 |
| 247 | 3376971 | 3377204 | + | NZ_CP015235.1 | Rhodococcus fascians D188 |
| 248 | 514744 | 514956 | + | NZ_CP020468.1 | Actinomyces gaoshouyii |
| 249 | 906669 | 906881 | + | NZ_CP017812.1 | Boudabousia tangfeifanii |
| 250 | 763587 | 763802 | + | NZ_CP038213.1 | Ornithinimicrobium flavum |
| 251 | 386781 | 386996 | + | NZ_LR215047.1 | Mycoplasma arthritidis |
| 252 | 358616 | 358819 | + | NZ_LT632322.1 | Murdochiella vaginalis |
| 253 | 2514805 | 2515035 | - | NZ_CP038254.1 | Legionella israelensis |
| 254 | 507236 | 507457 | + | NZ_CP066065.1 | Schaalia meyeri |
| 255 | 125908 | 126111 | + | NZ_LT635480.1 | Ndongobacter massiliensis |
| 256 | 7327461 | 7327685 | - | NZ_CP023865.1 | Actinoplanes teichomyceticus ATCC 31121 |
| 257 | 2792963 | 2793169 | + | NZ_CP014671.1 | Immundisolibacter cernigliae |
| 258 | 263101 | 263301 | + | NZ_CP012541.1 | Campylobacter concisus |
| 259 | 5306487 | 5306696 | + | NZ_LR134501.1 | Nocardiopsis dassonvillei |
| 260 | 1795718 | 1795930 | - | NZ_LS483427.1 | Arcanobacterium haemolyticum |
| 261 | 1148175 | 1148384 | + | NC_013521.1 | Sanguibacter keddieii DSM 10542 |
| 262 | 2062312 | 2062545 | + | NZ_CP027793.1 | Rhodococcus hoagii |
| 263 | 64081 | 64284 | + | NC_014810.2 | Helicobacter felis ATCC 49179 |
| 264 | 1692790 | 1692990 | - | NZ_AP022826.1 | Nitrosophilus labii |
| 265 | 190310 | 190510 | - | NZ_CP041070.1 | Arcobacter anaerophilus |
| 266 | 848078 | 848281 | + | NZ_LN907858.1 | Helicobacter typhlonius |
| 267 | 1821139 | 1821342 | + | NZ_CP021886.1 | Helicobacter apodemus |
| 268 | 135009 | 135209 | + | NZ_CP012547.1 | Campylobacter pinnipediorum subsp. pinnipediorum |
| 269 | 973746 | 973949 | + | NZ_CP014991.1 | Helicobacter himalayensis |
| 270 | 6419785 | 6420006 | + | NZ_CP031455.1 | Streptomyces olivoreticuli subsp. olivoreticuli |
| 271 | 2691809 | 2692009 | + | NZ_CP014476.1 | Methylomonas denitrificans |
| 272 | 250295 | 250507 | - | NZ_CP014228.1 | Actinomyces radicidentis |
++ More..