Result : P58061
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Probable protein-export membrane protein SecG |
| NCBI Accession ID | L43967.2 |
| Organism | Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) |
| Left | 131149 |
| Right | 131382 |
| Strand | + |
| Nucleotide Sequence | ATGCATCCAATCCAAATAGTAATGTTCATTATGGCTGTTATCTGTTTAATTATTGGACTTTTGCTTTCTAACCATGGTTCTACTGGAGGATTAGCTTCTCTATCAGGTCAGGACTTGGAGATCTTTCGTAAAACCAAAGATAGGGGTTTTGTAAAGATCTTACAGATTATCATGTTTATCTTAGTAGTTTTATTTTTAATTCTTGGGTTGATATTTAGTTTTGCACCAAGATAA |
| Sequence | MHPIQIVMFIMAVICLIIGLLLSNHGSTGGLASLSGQDLEIFRKTKDRGFVKILQIIMFILVVLFLILGLIFSFAPR |
| Source of smORF | Swiss-Prot |
| Function | Involved in protein export. Participates in an early event of protein translocation (By similarity). {ECO:0000250}. |
| Pubmed ID | 7569993 |
| Domain | CDD:415590 |
| Functional Category | Others |
| Uniprot ID | P58061 |
| ORF Length (Amino Acid) | 77 |
++ More..
| Conservation Analysis |
No. of Species: 4
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 131149 | 131382 | + | NC_000908.2 | Mycoplasma genitalium G37 |
| 2 | 292511 | 292741 | + | NZ_CP010546.1 | Mycoplasma pneumoniae FH |
| 3 | 855570 | 855803 | + | NC_016638.1 | Mycoplasma haemocanis str. Illinois |
| 4 | 1082818 | 1083051 | + | NC_014970.1 | Mycoplasma haemofelis str. Langford 1 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000908.2
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF17876.3 | 1.0 | 4 | 269.5 | same-strand | Cold shock domain |
++ More..