Result : P58042
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Prophage outer membrane lipoprotein RzoR (o-spanin) (Outer membrane lipoprotein Rz1 from lambdoid prophage Rac) (Spanin from lambdoid prophage Rac, outer membrane subunit) |
| NCBI Accession ID | U00096.3 |
| Organism | Escherichia coli (strain K12) |
| Left | 1423400 |
| Right | 1423585 |
| Strand | + |
| Nucleotide Sequence | ATGCGAAAGCTGAAAATGATGCTCTGCGTGATGATGTTGCCGCTGGTCGTCGTCGGTTGCACATCAAAGCAGTCTGTCAGTCAGTGCGTGAAGCCACCACCGCCTCCGGCGTGGATAATGCAGCCTCCCCCCGACTGGCAGACACCGCTGAACGGGATTATTTCACCCTCCGGGAACGACTGGTAA |
| Sequence | MRKLKMMLCVMMLPLVVVGCTSKQSVSQCVKPPPPPAWIMQPPPDWQTPLNGIISPSGNDW |
| Source of smORF | Swiss-Prot |
| Function | Component of the spanin complex that disrupts the outer membrane and causes cell lysis during virus exit. The spanin complex conducts the final step in cell lysis by disrupting the outer membrane after holin and endolysin action have permeabilized the inner membrane and degraded the host peptidoglycans (By similarity). {ECO:0000250}. |
| Pubmed ID | 9097039 9278503 16738553 |
| Domain | CDD:368737 |
| Functional Category | Others |
| Uniprot ID | P58042 |
| ORF Length (Amino Acid) | 61 |
++ More..
| Conservation Analysis |
No. of Species: 35
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2326850 | 2327035 | - | NZ_LR134340.1 | Escherichia marmotae |
| 2 | 1423400 | 1423585 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 3 | 578327 | 578509 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 4 | 2131613 | 2131795 | - | NZ_AP014857.1 | Escherichia albertii |
| 5 | 1340678 | 1340860 | + | NZ_AP014857.1 | Escherichia albertii |
| 6 | 1627713 | 1627895 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 7 | 2691314 | 2691499 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 8 | 2183741 | 2183926 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 9 | 1779200 | 1779385 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 10 | 1946498 | 1946683 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 11 | 2919335 | 2919520 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 12 | 2234698 | 2234883 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 13 | 1184207 | 1184392 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 14 | 1274756 | 1274941 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 15 | 1560260 | 1560466 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 16 | 36926 | 37108 | + | NZ_CP068597.1 | Paenibacillus sonchi |
| 17 | 1115885 | 1116073 | + | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
| 18 | 978008 | 978196 | + | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
| 19 | 3043778 | 3043948 | - | NZ_CP012264.1 | Cronobacter condimenti 1330 |
| 20 | 368899 | 369099 | + | NZ_CP027107.1 | Cronobacter sakazakii |
| 21 | 1645587 | 1645739 | - | NZ_CP027107.1 | Cronobacter sakazakii |
| 22 | 930686 | 930838 | + | NZ_CP027107.1 | Cronobacter sakazakii |
| 23 | 1684386 | 1684589 | - | NZ_CP028271.1 | Mixta intestinalis |
| 24 | 2965229 | 2965432 | - | NZ_LR134201.1 | Cedecea lapagei |
| 25 | 919224 | 919412 | + | NZ_LR134201.1 | Cedecea lapagei |
| 26 | 4032937 | 4033116 | - | NC_005126.1 | Photorhabdus laumondii subsp. laumondii TTO1 |
| 27 | 3432991 | 3433167 | - | NC_005126.1 | Photorhabdus laumondii subsp. laumondii TTO1 |
| 28 | 4420599 | 4420775 | - | NC_005126.1 | Photorhabdus laumondii subsp. laumondii TTO1 |
| 29 | 4874454 | 4874666 | - | NZ_CP045769.1 | Enterobacter cancerogenus |
| 30 | 1552551 | 1552751 | - | NZ_CP045769.1 | Enterobacter cancerogenus |
| 31 | 1003408 | 1003605 | + | NC_010554.1 | Proteus mirabilis HI4320 |
| 32 | 1038880 | 1039077 | + | NC_010554.1 | Proteus mirabilis HI4320 |
| 33 | 3690101 | 3690280 | - | NC_012962.1 | Photorhabdus asymbiotica |
| 34 | 4187320 | 4187499 | + | NC_012962.1 | Photorhabdus asymbiotica |
| 35 | 1843749 | 1843907 | - | NZ_CP060401.1 | Xenorhabdus nematophila |
| 36 | 3528460 | 3528657 | - | NZ_CP029736.1 | Providencia rettgeri |
| 37 | 2609839 | 2610036 | - | NZ_CP072455.1 | Xenorhabdus budapestensis |
| 38 | 2759320 | 2759517 | - | NZ_CP048796.1 | Providencia vermicola |
| 39 | 1613095 | 1613298 | + | NZ_CP048796.1 | Providencia vermicola |
| 40 | 1494500 | 1494709 | + | NZ_CP048796.1 | Providencia vermicola |
| 41 | 1684188 | 1684340 | + | NZ_CP013940.1 | Cronobacter malonaticus LMG 23826 |
| 42 | 612662 | 612871 | + | NZ_CP007230.1 | Yersinia similis |
| 43 | 2502615 | 2502812 | - | NZ_CP026377.1 | Mixta gaviniae |
| 44 | 2398145 | 2398342 | - | NZ_CP026377.1 | Mixta gaviniae |
| 45 | 1558110 | 1558274 | + | NZ_CP035129.1 | Kosakonia cowanii |
| 46 | 3084877 | 3085083 | - | NZ_CP014007.2 | Kosakonia oryzae |
| 47 | 2047719 | 2047868 | + | NZ_CP014007.2 | Kosakonia oryzae |
| 48 | 573093 | 573269 | - | NZ_CP011104.1 | Photorhabdus thracensis |
| 49 | 956421 | 956627 | - | NZ_CP011078.1 | Yersinia ruckeri |
| 50 | 1252424 | 1252612 | + | NZ_CP012871.1 | [Enterobacter] lignolyticus |
| 51 | 3014199 | 3014354 | - | NZ_CP012266.1 | Cronobacter dublinensis subsp. dublinensis LMG 23823 |
| 52 | 1250156 | 1250356 | + | NC_013892.1 | Xenorhabdus bovienii SS-2004 |
| 53 | 689316 | 689516 | - | NC_013892.1 | Xenorhabdus bovienii SS-2004 |
| 54 | 2021612 | 2021803 | - | NZ_LR134494.1 | Serratia quinivorans |
| 55 | 1423118 | 1423324 | - | NZ_CP009781.1 | Yersinia aldovae 670-83 |
| 56 | 2864069 | 2864272 | + | NZ_CP023009.1 | Lonsdalea britannica |
| 57 | 3123185 | 3123373 | - | NZ_CP043318.1 | Enterobacter chengduensis |
| 58 | 5724537 | 5724689 | - | NZ_CP067022.1 | Pseudomonas cannabina pv. alisalensis |
| 59 | 409060 | 409251 | - | NZ_CP047495.1 | Pectobacterium brasiliense |
| 60 | 1713652 | 1713858 | + | NZ_LR134475.1 | Klebsiella aerogenes |
| 61 | 962311 | 962499 | + | NZ_CP023525.1 | Cedecea neteri |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_LR134340.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF03245.15 | 0.97 | 34 | -188 | same-strand | Bacteriophage Rz lysis protein |
| 2 | PF00959.21 | 0.77 | 27 | 226 | same-strand | Phage lysozyme |
++ More..