Result : P58035
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Putative phosphotransferase enzyme IIB component SgcB (EC 2.7.1.-) (Putative PTS system EIIB component) |
| NCBI Accession ID | U00096.3 |
| Organism | Escherichia coli (strain K12) |
| Left | 4530255 |
| Right | 4530533 |
| Strand | - |
| Nucleotide Sequence | ATGAAAAAGATCCTTGTGGCATGCGGTACCGGCATGTCGACTTCAACCATGATTGCACACAAGCTGCAAGAGTTCCTGACTGAACAGGGCATTTCAGCCACTACCGCCCAATGCTGTCTGAATGAGATCCCTCTTAACTGTAACGGTATGGACCTTATTGTAACCTCCATGCGAACCAACAGTGATTACGGCATCCCTACGCTTAATGGCGCCGCCCTGCTCACAGGGATCAACGACGACGCGTTAAAACAACAAATCAAGGCTCTGTTAACTCAATAA |
| Sequence | MKKILVACGTGMSTSTMIAHKLQEFLTEQGISATTAQCCLNEIPLNCNGMDLIVTSMRTNSDYGIPTLNGAALLTGINDDALKQQIKALLTQ |
| Source of smORF | Swiss-Prot |
| Function | The phosphoenolpyruvate-dependent sugar phosphotransferase system (sugar PTS), a major carbohydrate active -transport system, catalyzes the phosphorylation of incoming sugar substrates concomitantly with their translocation across the cell membrane. {ECO:0000250}. |
| Pubmed ID | 9278503 16738553 |
| Domain | CDD:415825 |
| Functional Category | Others |
| Uniprot ID | P58035 |
| ORF Length (Amino Acid) | 92 |
++ More..
| Conservation Analysis |
No. of Species: 9
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 4530255 | 4530533 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 2 | 480228 | 480506 | + | NZ_CP033744.1 | Citrobacter freundii |
| 3 | 3868994 | 3869272 | + | NZ_LT556085.1 | Citrobacter amalonaticus |
| 4 | 3074958 | 3075236 | - | NZ_CP045205.1 | Citrobacter telavivensis |
| 5 | 1702910 | 1703188 | + | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
| 6 | 4107398 | 4107676 | + | NZ_CP053416.1 | Salmonella bongori |
| 7 | 2094770 | 2095048 | - | NZ_CP034752.1 | Jinshanibacter zhutongyuii |
| 8 | 2019414 | 2019692 | - | NZ_CP029185.2 | Limnobaculum parvum |
| 9 | 3776912 | 3777190 | - | NZ_CP048796.1 | Providencia vermicola |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000913.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00455.24 | 1.0 | 9 | 3373 | same-strand | DeoR C terminal sensor domain |
| 2 | PF08220.14 | 1.0 | 9 | 3373 | same-strand | DeoR-like helix-turn-helix domain |
| 3 | PF00834.21 | 1.0 | 9 | 2721.5 | same-strand | Ribulose-phosphate 3 epimerase family |
| 4 | PF00359.24 | 1.0 | 9 | 2275 | same-strand | Phosphoenolpyruvate-dependent sugar phosphotransferase system, EIIA 2 |
| 5 | PF03437.17 | 1.0 | 9 | 1338 | same-strand | BtpA family |
| 6 | PF03611.16 | 1.0 | 9 | 13 | same-strand | PTS system sugar-specific permease component |
| 7 | PF05343.16 | 1.0 | 9 | 0 | same-strand | M42 glutamyl aminopeptidase |
| 8 | PF01546.30 | 1.0 | 9 | 0 | same-strand | Peptidase family M20/M25/M40 |
++ More..