Result : P58034
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Inner membrane protein YmgF |
| NCBI Accession ID | U00096.3 |
| Organism | Escherichia coli (strain K12) |
| Left | 1218983 |
| Right | 1219201 |
| Strand | + |
| Nucleotide Sequence | ATGAACAATAGTAATAATCTGGATTATTTCACTCTCTATATCATATTTTCCATTGCATTTATGCTGATCACCCTCCTGGTCATCCTTATTGCAAAACCCAGTACCGGGCTGGGAGAAGTGCTTGTGACGATAAATTTGCTTAATGCCCTTGTTTGGCTGGCGATCAATCTGGTTAATCGATTAAGAGAAAGACTCGTCAACCACAGGGATCAGCAATAA |
| Sequence | MNNSNNLDYFTLYIIFSIAFMLITLLVILIAKPSTGLGEVLVTINLLNALVWLAINLVNRLRERLVNHRDQQ |
| Source of smORF | Swiss-Prot |
| Function | Could be involved in cell division. May participate in the stabilization of the cell divisome under specific conditions. {ECO:0000269|Pubmed:18978050}. |
| Pubmed ID | 9278503 16738553 15774864 18978050 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | P58034 |
| ORF Length (Amino Acid) | 72 |
++ More..
| Conservation Analysis |
No. of Species: 4
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1218983 | 1219201 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 2 | 1899913 | 1900131 | + | NZ_LR134340.1 | Escherichia marmotae |
| 3 | 1200097 | 1200297 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 4 | 1209100 | 1209318 | + | NZ_AP014857.1 | Escherichia albertii |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000913.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00563.22 | 0.75 | 3 | 151.5 | same-strand | EAL domain |
| 2 | PF12792.9 | 0.75 | 3 | 132 | same-strand | CSS motif domain associated with EAL |
| 3 | PF03797.21 | 0.75 | 3 | 1501 | same-strand | Autotransporter beta-domain |
| 4 | PF16456.7 | 1.0 | 4 | 1706.0 | opposite-strand | YmgD protein |
| 5 | PF13441.8 | 1.0 | 4 | 2045.0 | opposite-strand | YMGG-like Gly-zipper |
| 6 | PF13488.8 | 1.0 | 4 | 2045.0 | opposite-strand | Glycine zipper |
| 7 | PF03776.16 | 0.75 | 3 | 5078 | opposite-strand | Septum formation topological specificity factor MinE |
++ More..