Protein Information |
Information Type | Description |
---|---|
Protein name | Inner membrane protein YmgF |
NCBI Accession ID | U00096.3 |
Organism | Escherichia coli (strain K12) |
Left | 1218983 |
Right | 1219201 |
Strand | + |
Nucleotide Sequence | ATGAACAATAGTAATAATCTGGATTATTTCACTCTCTATATCATATTTTCCATTGCATTTATGCTGATCACCCTCCTGGTCATCCTTATTGCAAAACCCAGTACCGGGCTGGGAGAAGTGCTTGTGACGATAAATTTGCTTAATGCCCTTGTTTGGCTGGCGATCAATCTGGTTAATCGATTAAGAGAAAGACTCGTCAACCACAGGGATCAGCAATAA |
Sequence | MNNSNNLDYFTLYIIFSIAFMLITLLVILIAKPSTGLGEVLVTINLLNALVWLAINLVNRLRERLVNHRDQQ |
Source of smORF | Swiss-Prot |
Function | Could be involved in cell division. May participate in the stabilization of the cell divisome under specific conditions. {ECO:0000269|Pubmed:18978050}. |
Pubmed ID | 9278503 16738553 15774864 18978050 |
Domain | |
Functional Category | Others |
Uniprot ID | P58034 |
ORF Length (Amino Acid) | 72 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 1218983 | 1219201 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
2 | 1899913 | 1900131 | + | NZ_LR134340.1 | Escherichia marmotae |
3 | 1200097 | 1200297 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
4 | 1209100 | 1209318 | + | NZ_AP014857.1 | Escherichia albertii |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00563.22 | 0.75 | 3 | 151.5 | same-strand | EAL domain |
2 | PF12792.9 | 0.75 | 3 | 132 | same-strand | CSS motif domain associated with EAL |
3 | PF03797.21 | 0.75 | 3 | 1501 | same-strand | Autotransporter beta-domain |
4 | PF16456.7 | 1.0 | 4 | 1706.0 | opposite-strand | YmgD protein |
5 | PF13441.8 | 1.0 | 4 | 2045.0 | opposite-strand | YMGG-like Gly-zipper |
6 | PF13488.8 | 1.0 | 4 | 2045.0 | opposite-strand | Glycine zipper |
7 | PF03776.16 | 0.75 | 3 | 5078 | opposite-strand | Septum formation topological specificity factor MinE |