Protein name |
Protein TusB (tRNA 2-thiouridine synthesizing protein B) |
NCBI Accession ID |
|
Organism |
Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) (Acyrthosiphon pisum symbiotic bacterium) |
Left |
|
Right |
|
Strand |
|
Nucleotide Sequence |
|
Sequence |
MLHTLMKSPFETNVSLVISMLKKSDDFLALQDGVLIALKDNIFLKSIIMSPVKLYLIKEDVYARGIRKNISREFILINYIHFVSLTLKHKKQMTW |
Source of smORF |
Swiss-Prot |
Function |
Part of a sulfur-relay system required for 2-thiolation of 5-methylaminomethyl-2-thiouridine (mnm(5)s(2)U) at tRNA wobble positions. {ECO:0000255|HAMAP-Rule:MF_01564}. |
Pubmed ID |
10993077
|
Domain |
CDD:412512 |
Functional Category |
Others |
Uniprot ID |
P57596
|
ORF Length (Amino Acid) |
95 |