| Protein name |
Protein TusB (tRNA 2-thiouridine synthesizing protein B) |
| NCBI Accession ID |
|
| Organism |
Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) (Acyrthosiphon pisum symbiotic bacterium) |
| Left |
|
| Right |
|
| Strand |
|
| Nucleotide Sequence |
|
| Sequence |
MLHTLMKSPFETNVSLVISMLKKSDDFLALQDGVLIALKDNIFLKSIIMSPVKLYLIKEDVYARGIRKNISREFILINYIHFVSLTLKHKKQMTW |
| Source of smORF |
Swiss-Prot |
| Function |
Part of a sulfur-relay system required for 2-thiolation of 5-methylaminomethyl-2-thiouridine (mnm(5)s(2)U) at tRNA wobble positions. {ECO:0000255|HAMAP-Rule:MF_01564}. |
| Pubmed ID |
10993077
|
| Domain |
CDD:412512 |
| Functional Category |
Others |
| Uniprot ID |
P57596
|
| ORF Length (Amino Acid) |
95 |