| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C (Asp/Glu-ADT subunit C) (EC 6.3.5.-) |
| NCBI Accession ID | CP000702.1 |
| Organism | Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) |
| Left | 679042 |
| Right | 679332 |
| Strand | - |
| Nucleotide Sequence | ATGATAAAGGTTACAAAGGACCTGGTACTTCATCTTGAAAATCTGGCAAGGTTAGAACTCTCCGAAGACCAGAGAGAAAGTCTGATGAAAGATTTTCAGGAGATACTCGATTACGTGGAGCTCCTCAACGAAGTCGACGTGGAGGGTGTGGAGCCAATGTACACACCCGTTGAGGACAGCGCCAAACTCAGAAAAGGAGATCCGAGGTTCTTTGAAATGCGGGACCTCATAAAGAAGAACTTCCCGGAAGAAAAAGACGGTCACATAAAAGTCCCCGGAATCCACAGATGA |
| Sequence | MIKVTKDLVLHLENLARLELSEDQRESLMKDFQEILDYVELLNEVDVEGVEPMYTPVEDSAKLRKGDPRFFEMRDLIKKNFPEEKDGHIKVPGIHR |
| Source of smORF | Swiss-Prot |
| Function | Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln). {ECO:0000255|HAMAP-Rule:MF_00122}. |
| Pubmed ID | |
| Domain | CDD:412411 |
| Functional Category | Others |
| Uniprot ID | A5IKG9 |
| ORF Length (Amino Acid) | 96 |
| Conservation Analysis |
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 915488 | 915778 | + | NC_013642.1 | Thermotoga naphthophila RKU-10 |
| 2 | 679042 | 679332 | - | NC_009486.1 | Thermotoga petrophila RKU-1 |
| 3 | 681134 | 681424 | - | NC_023151.1 | Thermotoga maritima MSB8 |
| 4 | 431204 | 431494 | - | NC_011978.1 | Thermotoga neapolitana DSM 4359 |
| 5 | 877342 | 877632 | - | NZ_AP014509.1 | Thermotoga caldifontis AZM44c09 |
| 6 | 786647 | 786937 | + | NC_022795.1 | Pseudothermotoga hypogea DSM 11164 = NBRC 106472 |
| 7 | 1051749 | 1052039 | + | NC_015707.1 | Pseudothermotoga thermarum DSM 5069 |
| 8 | 655940 | 656230 | - | NZ_AP014510.1 | Thermotoga profunda AZM34c06 |
| 9 | 682141 | 682431 | - | NC_009828.1 | Pseudothermotoga lettingae TMO |
| 10 | 675306 | 675596 | - | NC_022792.1 | Pseudothermotoga elfii DSM 9442 = NBRC 107921 |
| Neighborhood Conservation Analysis |
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02021.19 | 1.0 | 10 | -3.0 | same-strand | Uncharacterised protein family UPF0102 |
| 2 | PF01668.20 | 0.9 | 9 | 332 | same-strand | SmpB protein |
| 3 | PF00849.24 | 0.6 | 6 | 785.5 | same-strand | RNA pseudouridylate synthase |
| 4 | PF01479.27 | 0.6 | 6 | 785.5 | same-strand | S4 domain |
| 5 | PF02623.17 | 0.6 | 6 | 218.5 | same-strand | FliW protein |
| 6 | PF00669.22 | 0.6 | 6 | 708.0 | same-strand | Bacterial flagellin N-terminal helical region |
| 7 | PF05130.14 | 0.6 | 6 | 4271.0 | same-strand | FlgN protein |